KEGG   Hipposideros armiger (great roundleaf bat): 109380308Help
Entry
109380308         CDS       T04661                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04614  Renin-angiotensin system
hai04924  Renin secretion
hai05142  Chagas disease (American trypanosomiasis)
hai05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    109380308 (ACE)
   04614 Renin-angiotensin system
    109380308 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    109380308 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    109380308 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hai01002]
    109380308 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109380308 (ACE)
   04090 CD Molecules [BR:hai04090]
    109380308 (ACE)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109380308 (ACE)
Peptidases [BR:hai01002]
 Metallo Peptidases
  Family M2
   109380308 (ACE)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109380308 (ACE)
CD molecules [BR:hai04090]
 Proteins
  109380308 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 109380308
NCBI-ProteinID: XP_019493301
LinkDB All DBs
Position
Un
AA seq 1318 aa AA seqDB search
MGAVSGRPELGPRPRLLSLPLPLPLLLLLLLLPPSPPSALALDPTLQPEEFSADEAGAQL
FVKSFNPKAEQVLYQSTVASWAHDTNITEENARRQEEAALLNQEFAEVWGQKAKELYDPI
WQNFTDPVLRRVLSGVRILGPANLPLVKRQQYNSLLSSMNRIYSTAKVCYPNRNDTCWSL
DPELMHILSDSRNYALLLYAWEGWHNAVGIPLKPLYENFTVLSNEAHEQDGFSDTGEYWR
SWYESSTFVEDLEKIYHQLEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGDMWAQ
SWENIYDMVVPFPDKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESML
EKPNDGREVVCHASAWDFYNRKDFRIKQCTRVAMDQLSTVHHEMGHVQYYLQYKEQPVSL
RQGANPGFHEAIGDVLALSVSTPSHLYKIGLLDHVVNDTESDINYLLKMALEKIAFLPFG
YLVDQWRWGVFSGRTRPSRYNFDWWYLRTKYQGVCSPIARNETHFDAGAKFHVPHVTPYI
RYFVSFVLQFQFHQALCKEAGHQGPLHQCDIYQSTKAGDKLRTVLQAGSSRPWQEVLKDM
IGSDTLDAEPLLNYFQPVRQWLEEQNQRNGEVLGWPEYQWQPPMPDNYPEDIVLVTDEAE
ASKFVEEYDQKSQVVWNEYAEANWNYNTNITTEASKILLQKNIQMANHTLKYGTRARRFD
ITYFQNTTMKRMIHKIQDLERAALPVEELEEYNQILLDMETTYSVASVCHSNGTCLQLEP
DLTNLMATSRKYEDLLWAWKSWRDQVGRSILPFFPKYVELSNKAARLNGYEDAGQSWRST
YEMPTLERDLEQLFQELQPLYLNLHAYVRRALHRHYGPQHINLEGPIPAHLLGNMWAQTW
SNIYDLVVPFPSVPKMDATEAMIKQGWTPKRMFKEADNFFTSLGLLPVPPEFWSKSMLEK
PTDGREVVCHASAWDFYNGKDFRIKQCTTVNMEDLVVVHHEMGHIQYFMQYKDLPVTFRE
GANPGFHEAIGDVLALSVSTPKHLHSINLLSSNDDSYEQDINFLMKIALDKIAFIPFSYL
IDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVARSQGDFDPGAKFHIPSSVPYIRY
FVSFIIQFQFHEALCQAAGHEGSLHKCDIYKSKEAGKLLADAMKLGFSKPWPEAMKLITG
QPNMSASAMMKYFKPLLDWLLIENERHGEKLGWPQYNWTPDSARSEGSFPGNGHVNFLGL
NLEEQQARVGQWVLLFLGVVLLVATLGLAQRLFSLRHRNRHRPHHGPQFGSEVELRHS
NT seq 3957 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgtgtcgggccgccctgagctggggccgcggccacggctcctgtcactgccg
ctgccgctgccgctgctgctgctgctgctgctgttgccaccgtcgccacccagcgccctg
gctcttgaccccacgctgcagccagaagagttttccgccgacgaggctggggcgcagctc
ttcgtgaagagcttcaacccaaaagccgagcaggtgctgtaccagagcacagtcgccagc
tgggcgcacgacaccaacatcaccgaggagaatgcgcggcgccaggaggaagcagccctg
ctcaaccaggagtttgcagaggtctggggccagaaggccaaggagctgtatgacccaatc
tggcagaacttcaccgacccagtactgcgaagggtcctcagtggtgtacgcatcctgggg
cctgccaacctgcccctggtgaagcggcagcagtacaactctctgctaagcagcatgaac
agaatctactccaccgccaaggtctgctaccccaacaggaatgacacctgctggtccctg
gacccagagctcatgcatatcctgtctgactcgcgaaactacgccctgctgctgtatgcc
tgggagggctggcacaatgccgtgggcattcccctgaaacccctgtatgagaatttcact
gtcctcagcaatgaggcccacgagcaggacggcttctcagacacaggagaatactggcgc
tcctggtacgagtcgtccacctttgtggaggacctggagaaaatctaccatcagttagag
cccctctacttgaacctccatgcctacgtccgccgcgcactgcaccgccgctatggggac
agatacatcaacctccggggacccatccctgctcacctgctgggggacatgtgggcccag
agctgggaaaacatctatgacatggtggtgcctttccctgacaagcccaatctcgatgtt
accagcacaatggttcagaagggctggaacgctacgcacatgttccgggtggcagaggaa
ttcttcacatccctggggctcttgcccatgcctcctgagttttgggcagaatccatgctg
gagaaaccaaacgacgggcgtgaggtggtgtgccacgcctctgcctgggacttctacaac
aggaaagacttcaggatcaagcagtgcacacgggtcgctatggaccagctgtccacagtg
caccatgagatgggccacgtgcagtactacctacaatacaaggagcagcctgtctccctg
cgccaaggtgccaaccctggcttccatgaggccatcggggatgtgctggcgctctctgtg
tctactccttcacatctgtacaaaattggcctgctggaccatgttgtcaatgacacagaa
agcgacatcaattacttgttaaagatggcactggaaaaaattgccttcctgccctttggc
tacttggtggaccagtggcgttggggggtctttagtggacgcacccgcccttcccgctac
aactttgactggtggtatcttcgaaccaagtatcagggcgtctgttctccaattgcccga
aatgaaacccactttgatgcaggagctaagtttcatgtcccacatgtgacaccgtacatc
aggtactttgtgagttttgtcctgcagttccagttccatcaagccctgtgcaaggaggca
ggccaccagggcccactacaccagtgtgacatctaccagtccaccaaggcgggggacaag
ctccgaacggtgctgcaggcaggctcttcacggccctggcaggaggtactcaaggatatg
attggctcagataccctggacgctgagccactgctcaactacttccaaccagtccgtcag
tggctagaggagcagaaccagcggaacggcgaggtcctgggctggccggaatatcagtgg
cagccaccgatgcccgacaattacccggaggacattgttctggtgactgatgaggctgag
gccagcaagtttgtggaagaatatgaccagaaatcccaagtggtgtggaacgaatatgct
gaagccaactggaactacaacaccaacatcaccacagaggccagcaagatcctgctgcag
aagaacatacagatggcaaaccacaccttaaagtatggcacccgagcccggcggtttgat
atcacctacttccagaacaccaccatgaagcggatgatacacaagattcaggacctagag
cgggcagcactgcctgtcgaggagctggaggagtacaaccagatcctgctggacatggaa
accacttacagcgtggcctctgtgtgccactccaacggcacttgtctccagttagagcct
gatctgaccaatctgatggccacatcccggaaatatgaagacctgttatgggcatggaag
agctggcgagatcaggtgggaagatccatcctcccttttttcccaaaatatgtggaactc
tccaacaaggctgcccggctcaatggctacgaagacgcagggcaatcgtggagatctaca
tatgagatgccaaccctggagcgggatctggagcagctcttccaggagctgcagccgctc
tacctgaacctgcacgcctacgtgcgccgggccctgcaccgccactatgggccccagcac
atcaacctggagggccccattccggctcatctgctggggaacatgtgggcgcaaacctgg
tccaatatctatgacttggtggtgcccttcccttcagtccccaagatggatgccacggag
gccatgataaagcagggctggacacccaaaaggatgtttaaggaagcggataatttcttt
acctccctgggcctgctgcctgtgccccccgagttctggagcaagtcaatgctggagaag
ccgaccgacgggcgagaggtggtgtgccatgcgtccgcctgggacttctacaatggcaag
gacttcaggatcaagcagtgcaccaccgtgaacatggaggacctggtggtggtccaccat
gaaatgggccacatacagtatttcatgcagtacaaggacctgcctgtgaccttccgagag
ggtgccaaccctggctttcacgaggccattggggatgtgctggccctctcagtgtctacc
cccaagcacctacacagcatcaacctgctgagtagcaacgatgacagctacgagcaagac
atcaactttctgatgaaaatagcgctcgacaagatcgcctttatccccttcagctatctc
atcgaccagtggcgctggagggtgtttgatggaagcatcaccaaggagaactacaaccag
gagtggtggagcctcaggctgaagtaccagggcctctgccccccagtggccaggtctcaa
ggcgactttgaccccggagccaagttccacattccttcaagtgtgccttatatcaggtac
ttcgtcagtttcatcatccagttccagttccacgaggcgctgtgtcaggcggctggccac
gagggctccttgcacaaatgtgacatctacaagtccaaggaggcagggaagctcctggca
gatgccatgaagctgggcttcagtaagccatggccagaagccatgaagctgatcacgggc
cagcccaacatgtccgcctcagccatgatgaagtacttcaagccgctgctggactggctc
ctcattgagaacgagcggcacggggagaagctgggctggcctcagtacaactggacacca
gactccgctcgctcggaaggctcattcccgggcaacggccacgtcaacttcctgggcctg
aacctggaggagcagcaggcccgcgtgggccagtgggtgctgcttttcctgggcgtcgtc
ctgctggtggccaccttgggcctcgcccagcggctcttcagccttcgccaccgcaaccgc
caccggccccaccatgggccccagttcggctccgaggtggaactgagacactcctga

DBGET integrated database retrieval system