KEGG   Hipposideros armiger (great roundleaf bat): 109380308Help
Entry
109380308         CDS       T04661                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04614  Renin-angiotensin system
hai04924  Renin secretion
hai05142  Chagas disease (American trypanosomiasis)
hai05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    109380308 (ACE)
   04614 Renin-angiotensin system
    109380308 (ACE)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    109380308 (ACE)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    109380308 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hai01002]
    109380308 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109380308 (ACE)
   04090 CD molecules [BR:hai04090]
    109380308 (ACE)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109380308 (ACE)
Peptidases [BR:hai01002]
 Metallo Peptidases
  Family M2
   109380308 (ACE)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109380308 (ACE)
CD molecules [BR:hai04090]
 Proteins
  109380308 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 109380308
NCBI-ProteinID: XP_019493301
LinkDB All DBs
Position
Un
AA seq 1318 aa AA seqDB search
MGAVSGRPELGPRPRLLSLPLPLPLLLLLLLLPPSPPSALALDPTLQPEEFSADEAGAQL
FVKSFNPKAEQVLYQSTVASWAHDTNITEENARRQEEAALLNQEFAEVWGQKAKELYDPI
WQNFTDPVLRRVLSGVRILGPANLPLVKRQQYNSLLSSMNRIYSTAKVCYPNRNDTCWSL
DPELMHILSDSRNYALLLYAWEGWHNAVGIPLKPLYENFTVLSNEAHEQDGFSDTGEYWR
SWYESSTFVEDLEKIYHQLEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGDMWAQ
SWENIYDMVVPFPDKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESML
EKPNDGREVVCHASAWDFYNRKDFRIKQCTRVAMDQLSTVHHEMGHVQYYLQYKEQPVSL
RQGANPGFHEAIGDVLALSVSTPSHLYKIGLLDHVVNDTESDINYLLKMALEKIAFLPFG
YLVDQWRWGVFSGRTRPSRYNFDWWYLRTKYQGVCSPIARNETHFDAGAKFHVPHVTPYI
RYFVSFVLQFQFHQALCKEAGHQGPLHQCDIYQSTKAGDKLRTVLQAGSSRPWQEVLKDM
IGSDTLDAEPLLNYFQPVRQWLEEQNQRNGEVLGWPEYQWQPPMPDNYPEDIVLVTDEAE
ASKFVEEYDQKSQVVWNEYAEANWNYNTNITTEASKILLQKNIQMANHTLKYGTRARRFD
ITYFQNTTMKRMIHKIQDLERAALPVEELEEYNQILLDMETTYSVASVCHSNGTCLQLEP
DLTNLMATSRKYEDLLWAWKSWRDQVGRSILPFFPKYVELSNKAARLNGYEDAGQSWRST
YEMPTLERDLEQLFQELQPLYLNLHAYVRRALHRHYGPQHINLEGPIPAHLLGNMWAQTW
SNIYDLVVPFPSVPKMDATEAMIKQGWTPKRMFKEADNFFTSLGLLPVPPEFWSKSMLEK
PTDGREVVCHASAWDFYNGKDFRIKQCTTVNMEDLVVVHHEMGHIQYFMQYKDLPVTFRE
GANPGFHEAIGDVLALSVSTPKHLHSINLLSSNDDSYEQDINFLMKIALDKIAFIPFSYL
IDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVARSQGDFDPGAKFHIPSSVPYIRY
FVSFIIQFQFHEALCQAAGHEGSLHKCDIYKSKEAGKLLADAMKLGFSKPWPEAMKLITG
QPNMSASAMMKYFKPLLDWLLIENERHGEKLGWPQYNWTPDSARSEGSFPGNGHVNFLGL
NLEEQQARVGQWVLLFLGVVLLVATLGLAQRLFSLRHRNRHRPHHGPQFGSEVELRHS
NT seq 3957 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgtgtcgggccgccctgagctggggccgcggccacggctcctgtcactgccg
ctgccgctgccgctgctgctgctgctgctgctgttgccaccgtcgccacccagcgccctg
gctcttgaccccacgctgcagccagaagagttttccgccgacgaggctggggcgcagctc
ttcgtgaagagcttcaacccaaaagccgagcaggtgctgtaccagagcacagtcgccagc
tgggcgcacgacaccaacatcaccgaggagaatgcgcggcgccaggaggaagcagccctg
ctcaaccaggagtttgcagaggtctggggccagaaggccaaggagctgtatgacccaatc
tggcagaacttcaccgacccagtactgcgaagggtcctcagtggtgtacgcatcctgggg
cctgccaacctgcccctggtgaagcggcagcagtacaactctctgctaagcagcatgaac
agaatctactccaccgccaaggtctgctaccccaacaggaatgacacctgctggtccctg
gacccagagctcatgcatatcctgtctgactcgcgaaactacgccctgctgctgtatgcc
tgggagggctggcacaatgccgtgggcattcccctgaaacccctgtatgagaatttcact
gtcctcagcaatgaggcccacgagcaggacggcttctcagacacaggagaatactggcgc
tcctggtacgagtcgtccacctttgtggaggacctggagaaaatctaccatcagttagag
cccctctacttgaacctccatgcctacgtccgccgcgcactgcaccgccgctatggggac
agatacatcaacctccggggacccatccctgctcacctgctgggggacatgtgggcccag
agctgggaaaacatctatgacatggtggtgcctttccctgacaagcccaatctcgatgtt
accagcacaatggttcagaagggctggaacgctacgcacatgttccgggtggcagaggaa
ttcttcacatccctggggctcttgcccatgcctcctgagttttgggcagaatccatgctg
gagaaaccaaacgacgggcgtgaggtggtgtgccacgcctctgcctgggacttctacaac
aggaaagacttcaggatcaagcagtgcacacgggtcgctatggaccagctgtccacagtg
caccatgagatgggccacgtgcagtactacctacaatacaaggagcagcctgtctccctg
cgccaaggtgccaaccctggcttccatgaggccatcggggatgtgctggcgctctctgtg
tctactccttcacatctgtacaaaattggcctgctggaccatgttgtcaatgacacagaa
agcgacatcaattacttgttaaagatggcactggaaaaaattgccttcctgccctttggc
tacttggtggaccagtggcgttggggggtctttagtggacgcacccgcccttcccgctac
aactttgactggtggtatcttcgaaccaagtatcagggcgtctgttctccaattgcccga
aatgaaacccactttgatgcaggagctaagtttcatgtcccacatgtgacaccgtacatc
aggtactttgtgagttttgtcctgcagttccagttccatcaagccctgtgcaaggaggca
ggccaccagggcccactacaccagtgtgacatctaccagtccaccaaggcgggggacaag
ctccgaacggtgctgcaggcaggctcttcacggccctggcaggaggtactcaaggatatg
attggctcagataccctggacgctgagccactgctcaactacttccaaccagtccgtcag
tggctagaggagcagaaccagcggaacggcgaggtcctgggctggccggaatatcagtgg
cagccaccgatgcccgacaattacccggaggacattgttctggtgactgatgaggctgag
gccagcaagtttgtggaagaatatgaccagaaatcccaagtggtgtggaacgaatatgct
gaagccaactggaactacaacaccaacatcaccacagaggccagcaagatcctgctgcag
aagaacatacagatggcaaaccacaccttaaagtatggcacccgagcccggcggtttgat
atcacctacttccagaacaccaccatgaagcggatgatacacaagattcaggacctagag
cgggcagcactgcctgtcgaggagctggaggagtacaaccagatcctgctggacatggaa
accacttacagcgtggcctctgtgtgccactccaacggcacttgtctccagttagagcct
gatctgaccaatctgatggccacatcccggaaatatgaagacctgttatgggcatggaag
agctggcgagatcaggtgggaagatccatcctcccttttttcccaaaatatgtggaactc
tccaacaaggctgcccggctcaatggctacgaagacgcagggcaatcgtggagatctaca
tatgagatgccaaccctggagcgggatctggagcagctcttccaggagctgcagccgctc
tacctgaacctgcacgcctacgtgcgccgggccctgcaccgccactatgggccccagcac
atcaacctggagggccccattccggctcatctgctggggaacatgtgggcgcaaacctgg
tccaatatctatgacttggtggtgcccttcccttcagtccccaagatggatgccacggag
gccatgataaagcagggctggacacccaaaaggatgtttaaggaagcggataatttcttt
acctccctgggcctgctgcctgtgccccccgagttctggagcaagtcaatgctggagaag
ccgaccgacgggcgagaggtggtgtgccatgcgtccgcctgggacttctacaatggcaag
gacttcaggatcaagcagtgcaccaccgtgaacatggaggacctggtggtggtccaccat
gaaatgggccacatacagtatttcatgcagtacaaggacctgcctgtgaccttccgagag
ggtgccaaccctggctttcacgaggccattggggatgtgctggccctctcagtgtctacc
cccaagcacctacacagcatcaacctgctgagtagcaacgatgacagctacgagcaagac
atcaactttctgatgaaaatagcgctcgacaagatcgcctttatccccttcagctatctc
atcgaccagtggcgctggagggtgtttgatggaagcatcaccaaggagaactacaaccag
gagtggtggagcctcaggctgaagtaccagggcctctgccccccagtggccaggtctcaa
ggcgactttgaccccggagccaagttccacattccttcaagtgtgccttatatcaggtac
ttcgtcagtttcatcatccagttccagttccacgaggcgctgtgtcaggcggctggccac
gagggctccttgcacaaatgtgacatctacaagtccaaggaggcagggaagctcctggca
gatgccatgaagctgggcttcagtaagccatggccagaagccatgaagctgatcacgggc
cagcccaacatgtccgcctcagccatgatgaagtacttcaagccgctgctggactggctc
ctcattgagaacgagcggcacggggagaagctgggctggcctcagtacaactggacacca
gactccgctcgctcggaaggctcattcccgggcaacggccacgtcaacttcctgggcctg
aacctggaggagcagcaggcccgcgtgggccagtgggtgctgcttttcctgggcgtcgtc
ctgctggtggccaccttgggcctcgcccagcggctcttcagccttcgccaccgcaaccgc
caccggccccaccatgggccccagttcggctccgaggtggaactgagacactcctga

DBGET integrated database retrieval system