KEGG   Hipposideros armiger (great roundleaf bat): 109380372
Entry
109380372         CDS       T04661                                 

Gene name
IGF1R
Definition
(RefSeq) insulin like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04114  Oocyte meiosis
hai04140  Autophagy - animal
hai04144  Endocytosis
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04510  Focal adhesion
hai04520  Adherens junction
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04730  Long-term depression
hai04913  Ovarian steroidogenesis
hai04914  Progesterone-mediated oocyte maturation
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05205  Proteoglycans in cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109380372 (IGF1R)
   04014 Ras signaling pathway
    109380372 (IGF1R)
   04015 Rap1 signaling pathway
    109380372 (IGF1R)
   04066 HIF-1 signaling pathway
    109380372 (IGF1R)
   04068 FoxO signaling pathway
    109380372 (IGF1R)
   04151 PI3K-Akt signaling pathway
    109380372 (IGF1R)
   04152 AMPK signaling pathway
    109380372 (IGF1R)
   04150 mTOR signaling pathway
    109380372 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109380372 (IGF1R)
   04140 Autophagy - animal
    109380372 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    109380372 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109380372 (IGF1R)
   04520 Adherens junction
    109380372 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    109380372 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    109380372 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    109380372 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    109380372 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    109380372 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    109380372 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109380372 (IGF1R)
   05202 Transcriptional misregulation in cancer
    109380372 (IGF1R)
   05205 Proteoglycans in cancer
    109380372 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109380372 (IGF1R)
   05214 Glioma
    109380372 (IGF1R)
   05218 Melanoma
    109380372 (IGF1R)
   05215 Prostate cancer
    109380372 (IGF1R)
   05224 Breast cancer
    109380372 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109380372 (IGF1R)
   01522 Endocrine resistance
    109380372 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109380372 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hai04090]
    109380372 (IGF1R)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109380372 (IGF1R)
Protein kinases [BR:hai01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   109380372 (IGF1R)
CD molecules [BR:hai04090]
 Proteins
  109380372 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 109380372
NCBI-ProteinID: XP_019493398
LinkDB
Position
Un
AA seq 1367 aa
MKSGSGGGSLTSLWGLLFFSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTTINNEYNYRCWTTNHCQKMCPSACGKRACTENNECCHPECLGSCS
APDNAAACVACRHYYYAGVCVPTCPPNTYRFEGWRCVDRDFCANIPNAESSDTEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTNTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPSNKDIEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMATRSRNSTVADTYNVTEPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTTYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKISMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPALAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIIGSIKDEMEPGFREVSFYYSEENKPPEQEELDLEPENMESVPLDPSASSSSLPLPERH
SGHKAENGPGPGVLVLRASFDDRQPYAHMNGGRKNERALPLPQSSTC
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccctgacctcgctgtgggggctcctgtttttctcc
gccgcgctctcgctctggccaacgagtggagaaatctgcgggcctggcattgacattcgc
aacgactaccagcagctgaagcgcctggagaactgcacggtgatcgagggttacctgcac
atcctgctcatctccaaggcagaggactaccgcagctaccgcttccccaagctcacggtc
atcaccgagtacctgctgctgttccgtgtggccggcctcgagagcctcggagacctcttc
ccgaacctcacagtcatccgcggctggaaactcttctacaactacgccctggtcatcttt
gagatgactaacctcaaagatatcgggctttacaacctgaggaacattactcggggggcc
atcaggattgagaaaaatgccgacctctgttacctgtccacagtggactggtctctgatc
ctggatgccgtctccaacaactacattgtggggaacaaacccccgaaagaatgcggggac
ctgtgtccggggaccatggaggagaagccactgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggactacgaatcactgccagaaaatgtgcccgagtgcgtgcgga
aagcgggcgtgcaccgagaacaacgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcccgacaacgccgccgcctgcgtggcctgccgccactattactacgccggcgtctgc
gtgcccacctgcccacccaacacctaccgcttcgagggctggcgctgcgtggaccgcgac
ttctgtgccaacatccccaacgccgagagcagcgacaccgaggggtttgtgatccacgac
ggcgagtgcatgcaggagtgcccctcagggttcatccgcaatggcagccagagcatgtat
tgcatcccttgtgaaggtccttgtcccaaagtctgtgaggaagaaaagaaaacgaagacc
attgattcagtcacgtctgcgcagatgctccaaggatgcaccatcttcaagggcaatttg
ctcattaacatccgacgaggcaataacattgcttcggaactggagaatttcatggggctc
atcgaggtggtgacgggctatgtgaagatacgccattcccatgccttggtttccttgtcc
ttcctcaaaaacctccgccaaatcttaggagaggagcagctcgagggaaattactccttc
tacgtcctcgacaaccagaacttgcagcagctgtgggactgggaccaccgcaacctgacc
atcaaagccgggaaaatgtactttgctttcaaccccaaactgtgtgtctctgaaatttac
cgcatggaggaagtgacggggaccaaagggcgccagagcaaaggggacataaacaccagg
aacaatggagagagagcctcctgtgaaagtgatgtcctgcacttcacctccaccaacacg
tggaagaaccgcattatcatcacgtggcaccggtaccggcccccggactatagggacctc
atcagtttcaccgtctactacaaggaagcaccctttaaaaatgtaacagagtatgacggg
caggacgcctgtggctctaacagctggaacatggtggatgtggacctcccatccaacaag
gatatcgagcctggcatcttactgcatggcctgaagccctggacccagtacgctgtgtac
gtcaaggctgtgaccctcaccatggtggagaacgaccatatccgtggggccaagagtgaa
atcttgtacattcgcaccaatgcttcagttccttccattcccctggatgtcctttcagcc
tccaactcctcctctcagctcatcgtaaagtggaacccgccctctctgcccaatggcaac
ctgagttactacatcgtgaggtggcagcgacagcctcaggacagctacctctaccggcac
aattactgctccaaagacaaaatccccatcaggaagtacgccgacggcaccatcgacatt
gaggaggtgacagagaaccccaagaccgaagtgtgtgggggagagaaaggaccttgctgt
gcttgccccaaaaccgaagccgagaagcaggccgagaaggaggaggctgagtaccgcaaa
gtcttcgagaatttcctgcacaactccatctttgtgcccagacccgaaaggaagcggagg
gacgtcatgcaggtcgccaataccaccatggccacccgaagcaggaacagcacggtggcg
gacacctacaacgtcacggagccagaggagctggagacggaataccctttctttgagagc
agagtggacaacaaggagagaaccgtcatttccaacctccggccctttactttgtaccgc
attgatatccacagctgtaaccacgaggccgagaagctgggctgcagcgcctccaacttt
gtctttgcaagaaccatgcctgcagaaggagcagatgacattcctgggccggtgacctgg
gagccgaggcctgaaaactccatctttttaaagtggccagaacctgagaatcccaatgga
ttaattctaatgtatgaaataaaatacggatcacaagtcgaggatcagcgggaatgtgtg
tccagacaggagtacaggaagtatggaggcgccaagctgaaccggctcaacccaggcaac
tacacggcccggatccaggccacctcactgtctgggaacgggtcctggaccgaccctgtg
ttcttctacgtccaggccaagactacatatgaaaactttatccatttgatcatcgccctc
cctgtggccgtgctgctgatagtaggagggttggttatcatgttgtatgtcttccataga
aagagaaacaacagcaggctggggaatggagtgctgtatgcttctgtgaacccagagtac
tttagcgcggccgatgtgtacgtgcccgacgagtgggaggtcgctcgggagaagatcagc
atgagccgggagctgggccagggctcctttgggatggtgtacgaaggagtagccaagggc
gtggtcaaagatgagcccgaaacccgggtggccattaaaacggtcaacgaggccgcgagc
atgcgtgaaaggattgaattcctcaatgaggcttccgtgatgaaggaattcaactgtcac
catgtggtgcgtttgctgggtgtggtgtcccagggccagccgacgctggtcatcatggaa
ctgatgacacggggggacctcaaaagttacctcaggtctctgaggccagaaatggagaat
aatccagcccttgctcctcccagcctcagcaagatgatccagatggcgggcgagatcgcc
gacggcatggcatacctcaatgccaacaagttcgtccacagagaccttgctgcccgcaac
tgcatggtggccgaagatttcactgtcaaaatcggagattttggcatgacgagagacatc
tatgagactgactattaccggaaaggagggaaaggcctgctacccgtgcgttggatgtcc
cccgagtctctcaaggatggcgtcttcaccactcattccgatgtctggtcctttggggtt
gtcctctgggaaatcgccacgctggccgagcagccgtaccagggcctgtccaacgagcaa
gtgctgcgcttcgtcatggagggtggccttctggacaagccggacaactgccccgacatg
ctgttcgaactgatgcgtatgtgctggcagtacaaccccaagatgaggccctccttcctg
gagataatcggcagcatcaaggacgagatggagcccgggttccgggaggtctccttctac
tacagtgaggagaacaaaccgcctgagcaggaggagctggacctggagcccgagaacatg
gagagcgtccccctggacccctcggcctcctcctcgtccctgccgctgcctgaaagacac
tcaggacacaaggctgagaacggcccgggccccggtgtgctggtcctccgggccagcttc
gacgacagacagccttacgcgcacatgaacgggggacgcaagaatgagcgggccctgcct
ctgccccagtcttccacctgctga

DBGET integrated database retrieval system