KEGG   Hipposideros armiger (great roundleaf bat): 109380633
Entry
109380633         CDS       T04661                                 

Gene name
CCDC6
Definition
(RefSeq) coiled-coil domain containing 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05200  Pathways in cancer
hai05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109380633 (CCDC6)
  09162 Cancer: specific types
   05216 Thyroid cancer
    109380633 (CCDC6)
SSDB
Motif
Pfam: DUF2046 ATG16
Other DBs
NCBI-GeneID: 109380633
NCBI-ProteinID: XP_019493959
LinkDB
Position
Un
AA seq 476 aa
MADSASESDTDGAGGNSSGSAAMQSSCSSTSGGGGGGGGGGGGGGGKSGGIVISPFRLEE
LTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFK
KIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKI
KKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQP
VSAPPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMR
EENLRLQRKLQREMERREALCRQLSESESSLEMDDERCFNEMSAQGLRPRTVSSPIPYTP
SPSSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGASHGITRPSPRRSN
SPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPAVPSAATSQPTSSPHSVHPSSQP
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcggacagcgccagcgagagcgacacggacggagcggggggcaacagcagcggctcg
gccgccatgcagtcatcctgctcgtcgacctcgggcggcggcggcggtggcggcggcggg
ggaggcggcggcggtgggaagtcggggggcattgtcatctcgccgttccgcctggaggag
ctcaccaaccgcctggcctcgctgcagcaagagaacaaggtgctgaagatcgagctggag
acctacaaactcaagtgcaaggcgctgcaggaggagaaccgcgacctgcgcaaagccagc
gtgaccatccaagccagggctgagcaggaagaagaattcatcagtaacactttattcaag
aaaattcaggctttacagaaggagaaagaaacccttgctgtaaattacgagaaggaagaa
gagtttctcactaatgagctctccagaaaattgatgcagttgcagcatgagaaagctgaa
ttagaacagcatctcgagcaggagcaggaattccaggtcaacaaactgatgaagaaaatt
aaaaaactggagaatgataccatttcgaagcagcttacattagagcagttgagacgagag
aagattgaccttgaaaatactttggagcaagaacaagaagcgctagttaatcgtctttgg
aaaaggatggataaactcgaagctgaaaagcgaatcctgcaagagaaattagaccagccg
gtctcggcgcccccatcacctagagacatctccatggagatcgactcgccagaaaacatg
atgcgccacatcaggtttttaaagaacgaagtggagaggctgaagaagcaactgagggcc
gctcagttacagcattcagagaaaatggcgcagtacctggaggaggaacgtcacatgagg
gaggagaacttgaggctgcagaggaagctgcagagggagatggagagaagagaagccctc
tgtcgacagctctccgagagcgagtccagcttggaaatggatgacgaaaggtgttttaac
gagatgtctgcacagggattaagacctcgcactgtgtccagcccgatcccttacactcct
tctccgagctcaagcaggcctatctcacccggtctatcatatgcaagtcacacagttggc
ttcacgccacccacttcactgactagagccggaatgtcttattacaattccccgggtctt
cacgtgcagcatatgggagcatcccacggtatcacaaggccttcaccacggagaagcaac
agtcctgacaaattcaaacggcccacgccgcctccgtctcccaacacacagaccccggtc
cagccacctcccccgccgccgcccccacccatgcagcctgcggtcccctcggcagccacc
tcgcagcccacctcttcgccacattcggtgcatccctcctcccagccttaa

KEGG   Hipposideros armiger (great roundleaf bat): 109389488
Entry
109389488         CDS       T04661                                 

Gene name
NCOA4
Definition
(RefSeq) nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04216  Ferroptosis
hai05200  Pathways in cancer
hai05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    109389488 (NCOA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109389488 (NCOA4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    109389488 (NCOA4)
SSDB
Motif
Pfam: ARA70 DUF1373
Other DBs
NCBI-GeneID: 109389488
NCBI-ProteinID: XP_019510605
LinkDB
Position
Un
AA seq 643 aa
MEGPLGLPGVAFGAGAVSRMSTSQDQNGSSAREPLVRCCDARRDLELAIGGVLRAEQQIK
DNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYWLLGQFNCL
IHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADIAALRQAITTFGSLKTIQI
PEHLIAHASSSNVGPFLEKRGSVSLPEQQKSASGTPAVPLSEWLLGSKPASGHQAPYIPS
TNLQDWLTQKQTLENSQTSARTFSFFSNVWGNLKDLEKWLHKSQQQEVPEKPSYQRCTSC
STTGSFSDIEKVADLELLDQDEVDLSDWLVTPQESRKLEKPENGSSETSEKFKFLFQVFQ
ESYSVNDWLVKPDSCTNCRGNQPKGVEIENLGNLKCLNDHMEAKKPLSTPSVITEDWLVQ
DHQDPYKVEDVCKANEPCMSFAECVCDENCEKEALCKWLLEKEGKDKNGVPVEPKPEVEK
RIDPLNMWLCPSRKETAEQAKAPKAMAPSRIADSVQVIRNSPLSEWLITPSCKEGHPKEV
PGIEDSAGKQNATSPAATSWCPFNTADWVLPGKKTGNLGQLSSGEDKWLLRKKAKEVLLN
SPIQEERNFPPDCYGLPAVCDLFACMQLQVDKEKWLYRTPLQM
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggaaggtcccctcggattgcccggagttgcatttggagctggagcagtgagcagaatg
agtacttcacaggaccagaatggctccagtgctagagaaccccttgtgaggtgttgtgat
gcacggagggacttggagcttgcgattggtggagttctccgggctgaacagcaaattaaa
gataacttgcgagaggtcaaagcccagattcacagctgcataagccgtcacctggaatgc
cttcgaagccgtgaggtgtggctgtacgaacaggtagatctcatctatcagcttaaagag
gagacacttcagcagcaggcccaacagctctactggttactgggccagttcaattgtctt
attcatcaactggagtgcacccaaaacaaagatctagccaatcaggtctctgtgtgcttg
gagagactgggcagcttgaccctcaaacctgaagattcgactgtcctgctcttcgaagca
gacatagcagctctgcgccaggccattaccacgtttgggtccctgaagaccatccaaatt
cctgagcacttgatagctcatgctagttcatcaaatgttgggcccttcctggagaaaaga
ggctctgtatcattgccagagcagcagaagtcagcatccggcactccagctgtccctctc
agtgaatggcttcttggaagcaaacctgccagtggtcatcaggctccttacatacccagc
accaacctccaggactggctcacccaaaagcagaccttggaaaatagtcagacttctgcc
agaaccttcagtttcttcagtaatgtctggggcaacctaaaggacttggaaaagtggctc
cacaagagtcagcaacaagaagttcccgaaaaaccaagttaccaaaggtgtaccagctgt
tctaccaccggctccttctctgatattgagaaggttgctgatctagagcttcttgatcaa
gatgaagtggacctttctgattggctggtgacaccccaggaatcccgtaagctggagaag
cctgagaatggcagcagtgaaaccagtgagaagtttaagttcttgttccaggtgttccag
gagtcctacagtgtgaatgattggcttgtcaaacctgattcgtgtaccaattgtcggggc
aaccagcccaaaggcgtggagattgaaaacctgggcaatctgaagtgcctgaatgaccac
atggaggccaagaaacccttgtccactcccagcgtgatcactgaggattggcttgtccag
gaccatcaggacccgtataaagtagaagatgtctgcaaagccaatgagccctgtatgagc
tttgcagagtgtgtgtgtgatgaaaactgtgagaaggaagcgctctgtaagtggctgctg
gagaaagaaggaaaggataaaaatggggtgcctgtggaaccaaaacctgaagttgagaag
cgtatcgatcctctgaacatgtggctctgtccttccagaaaagagacagcagaacaagct
aaggcaccaaaggcaatggctccttctagaattgctgattccgtccaagtcataaggaac
agtcccctgtctgagtggctcatcacaccctcatgcaaagaaggacaccccaaggaagtg
cctggtatcgaggacagtgctggcaagcaaaacgccacaagccccgcagccacttcctgg
tgcccctttaacacagcagactgggtcttgccaggaaagaagacaggaaacctcggccag
ttatcctcaggagaagacaagtggctacttcgaaagaaggccaaggaagtattacttaat
tcacccatccaggaggagcgtaacttccccccagactgctatggtcttccagcagtttgt
gatctctttgcctgtatgcagcttcaagttgataaagaaaagtggttgtatcgaactcct
ctacagatgtga

KEGG   Hipposideros armiger (great roundleaf bat): 109395552
Entry
109395552         CDS       T04661                                 

Gene name
RET
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04020  Calcium signaling pathway
hai05200  Pathways in cancer
hai05216  Thyroid cancer
hai05223  Non-small cell lung cancer
hai05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109395552 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109395552 (RET)
   05230 Central carbon metabolism in cancer
    109395552 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    109395552 (RET)
   05223 Non-small cell lung cancer
    109395552 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109395552 (RET)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109395552 (RET)
Protein kinases [BR:hai01001]
 Receptor tyrosine kinases (RTK)
  RET family
   109395552 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD4 RET_CLD3 Pkinase Cadherin Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 109395552
NCBI-ProteinID: XP_019522179
LinkDB
Position
Un
AA seq 1110 aa
MAKTTVGLRWLLLLPLLGEAPLGLYFSRDAYWEKLYVDQPAGMPLLYVHALRDAPEEVPS
FRLGQHLYGAYRTRLHENNWIRIQEDTGLLYLNWSLDHRSWEKLSIRNGGFPLLTVYLQV
FLSPTSLREGECQWPGCARVYFSIMNNSFPACGSLKPRELCFLETDLSFRIRENRPPGTF
HQFRLLPMQFLCPNVSVTYRLLGGESQPFRCAADSLEVSTRWTLDRERREKYELVAACTV
RVGAREEEVMVPFPVTVYDEDDSAPTFLGGVDTASAVVEFKRKEGTVVATLHVFDADVVP
ASGELLRRYTSTLLPRDAWVLQTFRVEHLPNETLVQANSSFIRATVHDYRLVLNRSLPIS
ESRILQLAVLVNDSDFQGPGEGILLLHFNVSVVPVSLRLPSAYSFTVSRQAHRFAQVGKV
CVESCQEFTGIHVQYRLQPSSANCSALGVVTSAEDSTGTLFVNDTEALRRSECAQLQYTV
VASDRSTRRQAQAPLLVTLEGTYLAEEPGCPLSCAVSKRRPECEECGGLGSLTGRCEWRQ
GNGKGISRNFSTCSPSIKTCPDGHCDAVESKNPNICPQDCLRGGSIVGGHEPGERLGIKA
GFGTCSCFPEEKKCFCEPEDSQDPLCDELCRMVIAAAVLFSFITSVLLSTFCIHRYHKNA
HKPPIASAEMTFRRPAQAFPISYSSSGARRPSLDSMENQVSVDAFKIPEDPKWEFPRKNL
VLGKTLGEGEFGKVVEATAFRLKGKAGYTTVAVKMLKENASPNELRDLLSEFNLLKQVNH
PNVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRDSRKAGPGYVGSRGSHGSSYLDNPDER
ALTMGDLISFAWQISRGMRYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDS
YVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLL
KTGYRMERPDNCSEEMYSLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAASTPS
DSLLYDDGLSEEETPLVDCNNAPLPRTLPSTWIENKLYGMSDPNWPEESPVPLTKADGPN
TGCPRYANDSVYANWMVSPSAAPLMDSFDS
NT seq 3333 nt   +upstreamnt  +downstreamnt
atggcgaagacgacggtggggctgcggtggctgcttctgctgccgctgctcggcgaagcc
ccgctgggactctacttctccagggacgcttactgggagaagctgtatgtggaccagccg
gccggcatgcccctgctgtatgtccacgccctgcgtgatgcccccgaggaggtgcccagc
ttccgcctgggccagcacctctacggtgcctaccgcacgcggctgcacgagaacaactgg
atccgtatccaggaggacacaggccttctctaccttaactggagcctggaccacaggtcc
tgggagaagctcagcatccgcaatggcggcttccccctgctcaccgtctacctccaggtc
ttcctgtcgcccacatccctgcgtgagggtgagtgccagtggccaggctgtgctcgcgtg
tacttctccatcatgaacaactccttcccggcgtgtggctccctcaaaccccgggagctc
tgctttcttgagacagatctctcctttcgcattcgggagaacaggcctcctggcaccttc
caccagttccgcctgctgcccatgcagttcctctgccccaacgtcagcgtgacctacagg
ctcctgggaggtgagagccagcccttccgctgtgcggcggacagcctggaggtgagcacg
cgctggaccctggaccgcgagcgccgggagaagtacgagctggtggccgcgtgcacggtg
cgcgtaggcgcgcgcgaggaggaggtgatggtgcccttccccgtgaccgtgtatgatgag
gacgactcggcgcccaccttccttgggggcgtcgacaccgccagcgccgtggtggagttc
aagcggaaggagggcactgtggtggccacactacatgtctttgatgctgatgtggtgcca
gcatccggggagctcctgaggcggtacaccagtacactgctccccagagatgcctgggtc
ctccagacctttcgtgtggagcacttgcccaacgagaccttggtccaggccaacagcagc
ttcatacgggcaactgtgcatgactacaggctggttctcaaccgcagccttcccatctcc
gagagccgtatcctacagctggccgtgctggtcaacgactcggacttccagggccccggg
gagggcatcctcctcctccacttcaatgtgtcggtggtgccagtcagcttgcgcctgccc
agcgcctactcctttaccgtgagcaggcaagcccaccgctttgcccaggttgggaaagtc
tgtgtggaaagctgccaggagttcaccggcatccacgtgcagtacaggctgcagccctcc
agtgccaactgcagtgccctgggcgtcgttacctcagccgaggacagcacagggaccctg
tttgtgaatgacacagaggccctgcggcggtctgagtgtgcccagcttcaatacacagtg
gtggcctctgaccggtcgactcgcaggcaggcccaggccccactgcttgtcaccttggag
gggacatacttggctgaggagccgggttgccccctttcttgcgccgtcagcaagaggcgg
cccgagtgtgaggagtgcggaggcctgggctctctgacgggcaggtgcgagtggagacag
gggaatggcaaagggatctccaggaacttctccacctgctcccccagcatcaagacctgc
cctgacggccactgtgacgctgtggagagcaaaaatcccaacatctgcccccaggactgc
ctgcggggtggcagcatcgttggtgggcacgagccaggggagcgcctggggattaaagct
ggctttggtacctgcagctgcttccctgaggagaagaagtgcttctgtgagccggaagac
agccaggacccgctgtgcgatgagctgtgccgcatggtgattgcagcggccgtgctcttc
tctttcatcacctctgtgctgctgtccaccttctgcattcaccgctaccacaagaatgcc
cacaagcctcccattgcctcagccgagatgaccttccgccggccagcccaggccttcccc
atcagctactcctcatccggcgcccgccggccctcactggactccatggagaaccaggtc
tctgtggatgcattcaagatcccggaggatccaaagtgggaattccctcggaagaacttg
gttcttggaaaaactctgggagaaggtgaatttggaaaagtggtcgaagcaacagccttc
cggcttaaagggaaagcggggtacacaaccgtggccgtgaagatgctgaaagagaacgcc
tccccaaatgagctgcgggacctactgtcagaattcaacctcctgaagcaggtcaaccac
cccaacgtcatcaaactgtacggggcctgcagccaggatggcccgctcctgctcatcgtg
gagtacgccaagtatggctccctgaggggcttcctgcgggacagccgcaaggcggggccc
ggctacgtgggcagcaggggcagccatggctccagctacctggacaacccggacgagcgg
gccctgaccatgggcgacctcatctccttcgcctggcagatctcacggggcatgcggtac
ctggccgagatgaagctcgtccatcgggacttagctgccagaaatgtcctggtagccgag
gggcggaagatgaagatttcagattttggcctgtcccgagatgtgtacgaagaggattct
tacgtgaagaggagcaagggtcgaattccagtaaaatggatggcaattgagtcccttttc
gatcatatctacaccacccaaagtgatgtgtggtcctttggtgtcctgctatgggagatt
gtgaccctggggggcaacccctaccccgggattcctcctgagcggctcttcaaccttctg
aagacaggctaccggatggagaggcccgacaactgcagcgaggagatgtacagtctgatg
ctgcagtgctggaagcaggagccagacaagaggccagtgtttgccgacatcagcaaagac
ctggagaagatgatggttaagagaagagactacttggacctggccgcgtccaccccatct
gactccctgctttacgatgatggcctctcagaggaggagacgcccctggtggactgtaat
aatgctcccctccctcgaaccctcccctccacgtggattgaaaacaaactctatggcatg
tcagacccgaactggcctgaagagagtcctgtaccactcacgaaagccgatggccctaac
actgggtgtccaagatatgcaaatgatagtgtatatgctaactggatggtttcaccctca
gcggcaccattaatggactcgtttgatagttaa

DBGET integrated database retrieval system