KEGG   Hipposideros armiger (great roundleaf bat): 109380813
Entry
109380813         CDS       T04661                                 

Gene name
CALCOCO2
Definition
(RefSeq) calcium binding and coiled-coil domain 2
  KO
K21348  calcium-binding and coiled-coil domain-containing protein 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04137  Mitophagy - animal
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109380813 (CALCOCO2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109380813 (CALCOCO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109380813 (CALCOCO2)
   03029 Mitochondrial biogenesis [BR:hai03029]
    109380813 (CALCOCO2)
Membrane trafficking [BR:hai04131]
 Autophagy
  Xenophagy
   Cargo receptors
    109380813 (CALCOCO2)
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    109380813 (CALCOCO2)
SSDB
Motif
Pfam: MIF4G SKICH SANT_DAMP1_like GAS Crescentin
Other DBs
NCBI-GeneID: 109380813
NCBI-ProteinID: XP_019494335
LinkDB
Position
Un
AA seq 714 aa
MEDTLEDPPTSAVLLDHCHFSQVIFNNVEKFYVPGGDVTCYYTLTDHFIPRRKDWIGIFR
VGWKTTREYYTFMWVALPTDVKSELTKQQEVQFKAYYLPKDDEYYQFCYVDQDGVVRGAS
IPFQFCPENEEDILVVTTQGEVEEIEQHNSELCKENQELKDSCVSLQKQNSDMQAELQKK
QEELETLKSINKKLEQKVKEQDSREAELLQLKEQNQKISSENKKMKVRVDQLQAQLSTQE
KEMEKLVQGNQDKTEQLEHLKKEYGKLFLSLTEQWECQKTLKQTVEELKQKEATATKKQQ
ELTDQNFDLSKRLSENKIICDVLQKEKQNLEGENDILKRENSRMMSYMGLDFDSLPYQVP
TSEQGGAGQSPGLVYGNPYSESYEDDCADYPTLAEYVQDFLNHLTEQPGSFETEIEQFSE
TLPEWVTTDDAFQELVELIYQQATSIPNFSYMGACLCNYLSHHLTISSQSGSFRQLLLQR
CRTEYEVKDQAAKGNEETRKRFHAFVLFLGELYLNLETRGTNGQVTRGDIFQVALPELLN
ALLSNPVDDNLICAVKLLKLTGSVLEDVWKERGKTDMEEIFQRIENVVLDANCSRDIKQM
LLKLLELRLSNWGRVHVTSTYRKATPENDPNYFMNEPTFYTYDGVPFTASDSDYQEKYQE
LLEREDFFPDYEENGTDLSGAGDPYLDDIDDEMDPEIEEAYEKFCLESEHKQKQ
NT seq 2145 nt   +upstreamnt  +downstreamnt
atggaagacacattagaggacccccccacttcggctgtcttgctggatcactgtcatttc
tctcaggtcatctttaataatgtggagaagttctatgtccctggaggggatgtcacatgc
tattacaccctcaccgatcatttcattccccgtcgaaaggattggattggcatctttaga
gtgggatggaagacaacccgcgagtattacaccttcatgtgggttgctttgcccactgac
gtaaagagcgaattgaccaaacagcaggaagtacaatttaaagcttattacctgcccaag
gatgatgagtattaccagttctgctatgtggatcaggatggtgtggtccggggagcaagt
atccctttccagttctgtccagaaaatgaggaggacatcctggttgttaccactcagggt
gaggtggaagagattgagcagcacaacagtgagctttgcaaagaaaaccaggagctgaaa
gatagctgtgtcagcctccagaagcagaactcagacatgcaggcggagctccaaaagaag
caggaggagctagaaaccctaaagagcatcaacaagaagttggaacagaaagtgaaagag
caggacagcagggaggcagagctgcttcaactgaaagaacaaaaccagaaaatatcctca
gaaaataaaaagatgaaagtcagagtggatcagcttcaggcccagctgtcaactcaagag
aaagaaatggagaagcttgttcagggaaatcaagataagacagagcagttggagcacctg
aaaaaagaatatggcaagctctttctcagtttaactgaacagtgggagtgccagaagacg
ctcaagcagacagtggaggagttgaagcagaaagaagctacggcaacgaagaagcagcag
gagttaacggaccagaactttgacctgtcaaaaagactaagcgagaacaagattatatgc
gatgttctgcagaaagagaaacagaatttggaaggagaaaatgatattttgaagagggag
aacagcagaatgatgagttacatgggtctggattttgactctttgccatatcaagtgcct
acttcagaacaaggaggtgcaggacaaagcccgggactggtctatggaaacccatattct
gaatcctatgaagatgattgtgcggattatcccactctagcagaatatgttcaggatttc
ttgaatcatcttacagagcagcctggcagttttgaaactgaaattgaacagttttcagag
acactgccggagtgggttacaacagatgatgcttttcaagaacttgtggaactcatctat
caacaggccacatctattccaaatttctcttacatgggagcttgcctgtgtaattacctg
tcccatcatctgacaattagctcacagagtggcagcttccgtcaattgctgcttcaaaga
tgtcggactgaatatgaagttaaagatcaagctgcaaaagggaatgaagagactcgaaaa
cgattccatgcatttgtactctttctgggagaactttatcttaacctggagaccagagga
acaaatggacaggttacaagaggagatatttttcaggttgctcttccagagttgctgaat
gccctcctttctaatcctgtggatgacaatttaatttgtgcagttaaattactgaagttg
acagggtcagttttggaggatgtctggaaggaaagaggaaagactgatatggaagaaatt
tttcagagaattgaaaatgttgtcctagatgcaaattgcagcagagacataaaacagatg
ctcttgaagcttctagaactcaggttaagtaactggggtagagtccatgtaacctcaaca
tacagaaaagcaacgcctgaaaatgatcctaactattttatgaatgaaccaacattttac
acatatgatggtgttcctttcactgcatctgattcagattaccaagagaaatatcaagag
ttacttgaaagagaagacttttttccagattatgaagaaaatggaacagatttatcgggg
gctggtgatccatacttggatgatattgatgatgagatggacccagagatagaagaagct
tatgaaaagttttgtttggaatcagagcacaagcaaaaacagtaa

DBGET integrated database retrieval system