KEGG   Hipposideros armiger (great roundleaf bat): 109381072
Entry
109381072         CDS       T04661                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04064  NF-kappa B signaling pathway
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04657  IL-17 signaling pathway
hai04668  TNF signaling pathway
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109381072 (TRAF3)
   04668 TNF signaling pathway
    109381072 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109381072 (TRAF3)
   04621 NOD-like receptor signaling pathway
    109381072 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    109381072 (TRAF3)
   04657 IL-17 signaling pathway
    109381072 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381072 (TRAF3)
   05203 Viral carcinogenesis
    109381072 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109381072 (TRAF3)
  09172 Infectious disease: viral
   05162 Measles
    109381072 (TRAF3)
   05164 Influenza A
    109381072 (TRAF3)
   05161 Hepatitis B
    109381072 (TRAF3)
   05160 Hepatitis C
    109381072 (TRAF3)
   05168 Herpes simplex virus 1 infection
    109381072 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109381072 (TRAF3)
   05169 Epstein-Barr virus infection
    109381072 (TRAF3)
   05165 Human papillomavirus infection
    109381072 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Crescentin zf-C3HC4_2 MPS2 Spc7 Spc29 Cast Tropomyosin_1 KxDL T3SSipB FliJ BLOC1_2 DUF1664 GAS DUF3450 SPATA24 Exonuc_VII_L
Other DBs
NCBI-GeneID: 109381072
NCBI-ProteinID: XP_019494911
LinkDB
Position
Un
AA seq 568 aa
MESSKKMDSSGSLQTNPPLKLHPDRSAGTSVFVPEQGGYKERFVKTVEDKYKCEKCRLVL
CNPKQTECGHRFCETCTAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQIYCRNE
SRGCADQLTLGHLLVHLKNDCQFEELPCVRADCKERVLRKDLRDHVEKACKYREATCSHC
KSQVPMITLQKHEDTECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggagtcgagcaaaaagatggactcttccggctcactgcagaccaacccaccgctgaag
ctgcaccctgaccgtagcgccgggacgtcagtgttcgtccctgaacaaggaggttacaaa
gaaaggttcgtgaagaccgtggaggacaagtacaagtgcgagaagtgccgcctggtgctg
tgcaacccgaagcagaccgagtgcggacaccggttctgtgagacctgcacggccgccttg
ctgagttcctcaagcccaaaatgtactgcgtgtcaagaaagcatcattaaagataaggtg
tttaaggacaattgctgcaagagagagattctggctcttcagatatattgtaggaatgaa
agtcggggctgtgccgaccagttaacactgggacacctgctggtgcacttgaagaatgat
tgccagtttgaagagctgccgtgtgttcgtgctgactgcaaagaaagagtattgagaaaa
gacctgcgtgatcacgtggagaaggcctgtaaataccgcgaggccacgtgcagccactgc
aaaagtcaggttccaatgattacactgcagaaacacgaagacactgagtgtccctgtgtg
gtggtgtcctgcccgcataagtgcagtgtccagacccttctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagattaaggcccatgaggccagctccgcagtgcagcatgtg
aacttactcaaagagtggagcaattctctagaaaagaaggtttccttgctgcagaatgaa
agtgtagaaaaaaacaagagcatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaatacttcatttacag
cgagtgatagacagccaagccgagaaactgaaagagctcgacaaagagatccgccccttc
cggcagaactgggaggaggcagacagcatgaagagcagcgtggagtctctccagaaccga
gtgacggagctggaaagtgtggacaaaagcgcagggcaggcagctcggaacacaggcctg
ctggagtcccagctgagccgccatgaccagatgctcagtgtgcacgacatccgcctggca
gacatggacctgcgcttccaggtcctagagaccgccagctacaacggggtcctcatttgg
aagatccgtgactacaagcggcggaagcaggaggccgtcatggggaagacactgtccctg
tacagccagcccttctacaccggctactttggctataagatgtgtgcccgggtctacctg
aacggcgatggcatgggcaaggggacgcacttatcactgttttttgtcatcatgcgcgga
gaatatgacgctctgcttccgtggcccttcaagcagaaagtgacgctcatgctgatggat
caggggtcctctcggcggcatttgggagacgctttcaagccggaccccaacagtagcagc
ttcaagaaacccaccggggagatgaatatcgcctctggctgcccagtctttgtggcccaa
actgtgctagaaaacgggacgtatattaaagatgataccatttttattaaagtcatagtg
gatacttcggacctgcctgacccctga

DBGET integrated database retrieval system