KEGG   Hipposideros armiger (great roundleaf bat): 109381229
Entry
109381229         CDS       T04661                                 

Gene name
RXRA
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  retinoid X receptor alpha
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03320  PPAR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04659  Th17 cell differentiation
hai04919  Thyroid hormone signaling pathway
hai04920  Adipocytokine signaling pathway
hai04928  Parathyroid hormone synthesis, secretion and action
hai04932  Non-alcoholic fatty liver disease
hai04976  Bile secretion
hai05160  Hepatitis C
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05216  Thyroid cancer
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109381229 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109381229 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109381229 (RXRA)
   03320 PPAR signaling pathway
    109381229 (RXRA)
   04919 Thyroid hormone signaling pathway
    109381229 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    109381229 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    109381229 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381229 (RXRA)
   05202 Transcriptional misregulation in cancer
    109381229 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    109381229 (RXRA)
   05216 Thyroid cancer
    109381229 (RXRA)
   05222 Small cell lung cancer
    109381229 (RXRA)
   05223 Non-small cell lung cancer
    109381229 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109381229 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109381229 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109381229 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hai03310]
    109381229 (RXRA)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    109381229 (RXRA)
Nuclear receptors [BR:hai03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   109381229 (RXRA)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 109381229
NCBI-ProteinID: XP_019495246
LinkDB
Position
Un
AA seq 439 aa
MAAPSLHPSLGPGIGSSLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTP
TLGFGTSSPQLNSAMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLSYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANMGLNPNSPND
PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVRDG
ILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMHMDKAELGCLRAVVLFNPDSKGL
SNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQMT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggcggccccctcgctgcacccctccctggggcccggtatcggctcctcgctgggctcc
cctggacagctgcactctcccatcagcaccctgagctcccccatcaacggcatgggcccg
cccttctcggtcatcagctcccccatgggtccccactccatgtccgtgcccaccacaccc
accctgggctttggcaccagcagcccccagctcaactcggccatgaaccctgtcagtagc
agtgaagacatcaagcccccgctgggcctcaatggagtcctcaaagtcccggcccacccc
tcagggaacatggcgtccttcactaagcacatctgtgccatctgcggggaccgctcctca
ggcaagcactacggtgtgtacagctgcgagggctgtaagggcttcttcaagcggacggtg
cgcaaggacctgagctacacctgccgggacaacaaggactgcctgatcgacaagcgccag
cgcaaccgctgccagtactgccgctaccagaagtgcctggccatgggcatgaaacgggaa
gcggtgcaggaggagaggcagcggggcaaggaccggaatgagaacgaggtggagtccacg
agcagcgccaacgaggacatgcccgtggagaagattctggaggccgagctggccgtcgag
cccaagaccgagacgtacgtggaggcgaacatggggctgaaccccaactcgcccaacgac
ccggtcaccaacatttgccaagcagcggacaagcagctcttcaccctcgtggaatgggcc
aagcggatcccacacttctctgagctgcctctggacgaccaggtcatcctgctgagggca
ggctggaacgaactgctcatcgcctccttctcccaccggtccatagccgtgcgggatggg
attctcctcgcgaccgggctgcacgtgcaccggaacagcgcccacagtgcaggcgtgggc
gccatctttgacagggtgctgacggagctggtgtccaagatgagggacatgcacatggac
aaggcggagctgggctgcctgcgcgccgtcgtcctcttcaaccccgactccaaggggctg
tcgaacccggccgaggtggaggcgctgcgggagaaggtgtacgcgtccctggaggcctac
tgcaaacacaagtaccccgagcagccaggaaggtttgccaagctgctgctgcgtctcccg
gctctgcgttccatcggcctcaagtgcctggagcacctcttcttcttcaaactcatcggg
gacacgcccatcgacaccttcctcatggagatgctggaagctccgcaccaaatgacttag

KEGG   Hipposideros armiger (great roundleaf bat): 109385199
Entry
109385199         CDS       T04661                                 

Definition
(RefSeq) retinoic acid receptor RXR-gamma-like
  KO
K08526  retinoid X receptor gamma
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03320  PPAR signaling pathway
hai04659  Th17 cell differentiation
hai04919  Thyroid hormone signaling pathway
hai04920  Adipocytokine signaling pathway
hai04928  Parathyroid hormone synthesis, secretion and action
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05216  Thyroid cancer
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109385199
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109385199
   03320 PPAR signaling pathway
    109385199
   04919 Thyroid hormone signaling pathway
    109385199
   04928 Parathyroid hormone synthesis, secretion and action
    109385199
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109385199
   05202 Transcriptional misregulation in cancer
    109385199
  09162 Cancer: specific types
   05226 Gastric cancer
    109385199
   05216 Thyroid cancer
    109385199
   05222 Small cell lung cancer
    109385199
   05223 Non-small cell lung cancer
    109385199
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109385199
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hai03310]
    109385199
Transcription factors [BR:hai03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    109385199
Nuclear receptors [BR:hai03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   109385199
SSDB
Motif
Pfam: Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 109385199
NCBI-ProteinID: XP_019502713
LinkDB
Position
Un
AA seq 263 aa
MTTPSFFRAPAKTIHLQSSSPGHSGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSV
VGSPLNALGSPYRVITSTMGPPSGALAAPPGINLVAPPSSQLNVVNSVSISEDIKPLPGL
PGIGNMNYLSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDN
KDCLIDKRQRNRCQYCRYQKCLVMGMKREGEAPHCPPRSGDSSWHIRHGERQTRHGAGGV
RGGGWDDSGDHDFSRIAIECPLP
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaccacgcctagtttcttccgcgcacctgcaaagaccatccatctgcaaagcagctcc
cccggccactccggctccacgtccatgagcccgtcagcagccttgtccacagggaagccg
atggacagccaccccagctacacggacaccccggtcagtgctccgcggaccctgagtgtg
gtgggcagccccctcaatgccctgggctctccgtatcgcgtcatcacgtccaccatgggc
ccgccctcaggagctctggcagccccaccaggaatcaacctggttgccccacccagctcc
cagctcaatgtggtcaacagtgtcagcatttcagaggacatcaagcccttaccagggctt
cctgggattggaaacatgaactacctgtccaccagcccggggtctctggttaaacatatc
tgtgccatctgtggggacagatcctcaggaaagcactacggtgtgtacagctgtgaaggc
tgcaagggcttcttcaagagaaccataaggaaagacctcatctacacctgtcgcgacaac
aaggactgcctcatcgacaagcgccagcgcaaccgctgccagtactgccgctaccagaag
tgcctggtcatgggcatgaagagggaaggtgaggccccccactgccctccccgctcaggg
gacagcagctggcacatacgacatggtgagagacagacgcggcacggggcaggaggtgtt
cgagggggaggctgggatgactctggagatcatgatttctcgagaattgcaatcgaatgt
cccctgccctag

KEGG   Hipposideros armiger (great roundleaf bat): 109392300
Entry
109392300         CDS       T04661                                 

Definition
(RefSeq) retinoic acid receptor RXR-gamma-like
  KO
K08526  retinoid X receptor gamma
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03320  PPAR signaling pathway
hai04659  Th17 cell differentiation
hai04919  Thyroid hormone signaling pathway
hai04920  Adipocytokine signaling pathway
hai04928  Parathyroid hormone synthesis, secretion and action
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05216  Thyroid cancer
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109392300
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109392300
   03320 PPAR signaling pathway
    109392300
   04919 Thyroid hormone signaling pathway
    109392300
   04928 Parathyroid hormone synthesis, secretion and action
    109392300
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109392300
   05202 Transcriptional misregulation in cancer
    109392300
  09162 Cancer: specific types
   05226 Gastric cancer
    109392300
   05216 Thyroid cancer
    109392300
   05222 Small cell lung cancer
    109392300
   05223 Non-small cell lung cancer
    109392300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109392300
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hai03310]
    109392300
Transcription factors [BR:hai03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    109392300
Nuclear receptors [BR:hai03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   109392300
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 109392300
NCBI-ProteinID: XP_019516195
LinkDB
Position
Un
AA seq 457 aa
MNYLSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLI
DKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAESAGGGHEDMPVERILEAE
LAVEPKTESYGDMNMESSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLR
AGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQM
DKSELGCLRAIVLFNPGDCVRLGSGRGTGVRALRSQRRGEPREGPRALRWRLHVERGNLA
RPGGRGGRGARRAAAAQPARNGSAAAPRLPALRTPPSAAHAAAARAARPDPPRLPGSDSH
PGPWAAALPPRLGAAAAVPSPRGATRRAGRPEKAGAGGHVPARPARRGAGRPLPAASRAP
ASRAAAASGSGRGASSRVRSRRLRAPGSGSGGRVSES
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgaactacctgtccaccagcccggggtctctggttaaacatatctgtgccatctgtggg
gacagatcctcaggaaagcactacggtgtgtacagctgtgaaggctgcaagggcttcttc
aagagaaccataaggaaagacctcatctacacctgtcgcgacaacaaggactgcctcatc
gacaagcgccagcgcaaccgctgccagtactgccgctaccagaagtgcctggtcatgggc
atgaagagggaagctgtgcaagaggagaggcagaggagccgggagcgggctgagagcgag
gcggagagtgccggcggcggccacgaagacatgcccgtggagaggattctagaagctgag
cttgcggtggaaccaaagacggagtcctatggcgacatgaacatggagagctcgacgaat
gaccctgtcaccaacatatgccatgctgctgacaagcagctcttcactcttgttgagtgg
gccaaacgcatcccccacttctctgacctcaccttggaggaccaggtcattctgctccgg
gcagggtggaatgagctgctgattgcctccttctctcaccgctcggtctccgtgcaggat
ggcatcctcctggccacgggcttgcatgtccaccggagcagtgcccacagtgctggggtg
ggctccatctttgacagagttctgactgagctggtctccaaaatgaaggacatgcagatg
gataagtcggagctggggtgcctgcgagccatcgtgctgttcaacccaggtgactgcgtc
aggttggggagtggccggggcaccggcgtgcgggcgctgcggtcccagcggcgcggggag
ccccgcgaagggccgcgcgccctgaggtggcggctgcacgtggagagaggaaacttggcg
cgcccgggaggtcgcggcggacgaggggcgcgccgggcggcggccgcgcagccggctcgg
aacgggagcgcggcggcccctcggctccccgcgctccgcacccctccctccgccgcgcac
gcagccgcggcccgggcggcgcggccagatccgccccggctgccggggtccgactcgcac
ccaggaccgtgggccgccgccctcccgccccgcctcggagcagcagcggccgttccttcc
ccgagaggagcgacccgccgggcagggcgtcccgagaaggccggcgccggcggccacgtc
ccggcccggcccgcgcgccgaggagccgggcggccgcttcccgcagcctcgagggccccc
gcctcccgggccgcggctgcgtccggctccggccgcggggcgagctcgcgcgtcaggtcg
cggaggctgcgggcgccgggctccggctcgggcgggcgcgtttctgaaagttga

KEGG   Hipposideros armiger (great roundleaf bat): 109392460
Entry
109392460         CDS       T04661                                 

Gene name
RXRB
Definition
(RefSeq) retinoid X receptor beta
  KO
K08525  retinoid X receptor beta
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03320  PPAR signaling pathway
hai04659  Th17 cell differentiation
hai04919  Thyroid hormone signaling pathway
hai04920  Adipocytokine signaling pathway
hai04928  Parathyroid hormone synthesis, secretion and action
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05216  Thyroid cancer
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109392460 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109392460 (RXRB)
   03320 PPAR signaling pathway
    109392460 (RXRB)
   04919 Thyroid hormone signaling pathway
    109392460 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    109392460 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109392460 (RXRB)
   05202 Transcriptional misregulation in cancer
    109392460 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    109392460 (RXRB)
   05216 Thyroid cancer
    109392460 (RXRB)
   05222 Small cell lung cancer
    109392460 (RXRB)
   05223 Non-small cell lung cancer
    109392460 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109392460 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hai03310]
    109392460 (RXRB)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    109392460 (RXRB)
Nuclear receptors [BR:hai03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   109392460 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 109392460
NCBI-ProteinID: XP_019516486
LinkDB
Position
Un
AA seq 536 aa
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAATAAAAAAGEQQTP
EPEPGEAGRDGMGDSGRDSRSPDSSSPNPISQGPSPHSPPGPPLPSSAAPSLGGSGAPPP
PPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKP
PVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSC
RDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPV
DRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFS
SLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSL
SRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQ
KYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgtcttgggctgctcgcccgcccttcctcccccagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcgtcccggtggcggcggcgacgg
ccctggctggatcccgcagcgacggcggcagcggcggcagccggagaacaacaaaccccg
gagccggagccgggggaggctggacgggacgggatgggcgacagcgggcgggattcccga
agcccagacagttcctccccaaatcctatttcccaggggccctctccccattctcctcct
ggaccacccttaccctcttcagcagccccatctcttggaggctctggggcaccaccccca
cccccgatgccaccccccccactgggctcccctttcccagtcatcagctcttccatgggg
tcccctggtctgccccctccagctcccccaggattctccgggcctgtcagcagtccccag
attaactcaacagtgtcgctccctgggggtgggtctggcccccctgaagatgtgaagcca
ccagtcttaggggtccggggcctgcactgtccaccccctccaggtggccctggggctggc
aaacggctttgtgcaatctgcggggaccgaagctcaggcaaacactatggggtttatagt
tgtgagggctgcaaaggcttcttcaagcgcaccattcgtaaggacctgacctactcatgc
cgggacaacaaggactgcacggtggacaagcgccagcggaaccgctgtcagtactgccgc
tatcagaagtgcctggccacgggcatgaagagggaagcggtacaggaggagcgtcagcgg
gggaaggacaaggacggggatggggagggggctgggggagcccccgaggagatgcccgtg
gacaggatcctggaggcagaacttgctgtggagcagaagagtgaccagggcgttgagggt
cccgggggaaccgggggtagcggcagcagcccaaatgaccctgtgactaacatctgtcag
gcagctgacaaacagctattcacgcttgttgagtgggcgaagaggatcccacacttttcc
tccttgcctctggatgaccaggtcatattgctacgggcaggctggaatgagcttcttatt
gcctctttctcccaccgatccattgatgtgcgagatggcatcctcctcgccacaggtctt
catgtgcaccgcaactcagcccattctgcaggcgtgggagccatctttgataggtccctc
tccagggtgctgacagagctagtgtccaaaatgcgtgacatgaggatggacaagactgag
cttggctgcctgagggcaatcattctgttcaatccagatgccaagggcctctccaacccc
agcgaggtggaggtcctgcgcgagaaagtgtacgcatcactcgagacctattgcaaacag
aaataccctgagcagcagggacggtttgccaagctgctgctgcgtcttcctgccctcagg
tccattggccttaagtgtctagagcatctgtttttcttcaagctcattggcgacactccc
atcgacacctttctcatggagatgctggaggcgccccaccagctggcctga

DBGET integrated database retrieval system