KEGG   Hipposideros armiger (great roundleaf bat): 109381262
Entry
109381262         CDS       T04661                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04012  ErbB signaling pathway
hai04066  HIF-1 signaling pathway
hai04072  Phospholipase D signaling pathway
hai04136  Autophagy - other
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04218  Cellular senescence
hai04371  Apelin signaling pathway
hai04613  Neutrophil extracellular trap formation
hai04630  JAK-STAT signaling pathway
hai04659  Th17 cell differentiation
hai04714  Thermogenesis
hai04910  Insulin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04920  Adipocytokine signaling pathway
hai04930  Type II diabetes mellitus
hai04931  Insulin resistance
hai04935  Growth hormone synthesis, secretion and action
hai05010  Alzheimer disease
hai05014  Amyotrophic lateral sclerosis
hai05016  Huntington disease
hai05017  Spinocerebellar ataxia
hai05022  Pathways of neurodegeneration - multiple diseases
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05221  Acute myeloid leukemia
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109381262 (MTOR)
   04371 Apelin signaling pathway
    109381262 (MTOR)
   04630 JAK-STAT signaling pathway
    109381262 (MTOR)
   04066 HIF-1 signaling pathway
    109381262 (MTOR)
   04072 Phospholipase D signaling pathway
    109381262 (MTOR)
   04151 PI3K-Akt signaling pathway
    109381262 (MTOR)
   04152 AMPK signaling pathway
    109381262 (MTOR)
   04150 mTOR signaling pathway
    109381262 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109381262 (MTOR)
   04136 Autophagy - other
    109381262 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    109381262 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    109381262 (MTOR)
   04659 Th17 cell differentiation
    109381262 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109381262 (MTOR)
   04920 Adipocytokine signaling pathway
    109381262 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    109381262 (MTOR)
   04919 Thyroid hormone signaling pathway
    109381262 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    109381262 (MTOR)
   04213 Longevity regulating pathway - multiple species
    109381262 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    109381262 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381262 (MTOR)
   05206 MicroRNAs in cancer
    109381262 (MTOR)
   05205 Proteoglycans in cancer
    109381262 (MTOR)
   05230 Central carbon metabolism in cancer
    109381262 (MTOR)
   05231 Choline metabolism in cancer
    109381262 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109381262 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109381262 (MTOR)
   05212 Pancreatic cancer
    109381262 (MTOR)
   05225 Hepatocellular carcinoma
    109381262 (MTOR)
   05226 Gastric cancer
    109381262 (MTOR)
   05214 Glioma
    109381262 (MTOR)
   05221 Acute myeloid leukemia
    109381262 (MTOR)
   05215 Prostate cancer
    109381262 (MTOR)
   05224 Breast cancer
    109381262 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109381262 (MTOR)
   05014 Amyotrophic lateral sclerosis
    109381262 (MTOR)
   05016 Huntington disease
    109381262 (MTOR)
   05017 Spinocerebellar ataxia
    109381262 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    109381262 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109381262 (MTOR)
   04931 Insulin resistance
    109381262 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109381262 (MTOR)
   05168 Herpes simplex virus 1 infection
    109381262 (MTOR)
   05163 Human cytomegalovirus infection
    109381262 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109381262 (MTOR)
   05165 Human papillomavirus infection
    109381262 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109381262 (MTOR)
   01522 Endocrine resistance
    109381262 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109381262 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109381262 (MTOR)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109381262 (MTOR)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   109381262 (MTOR)
Membrane trafficking [BR:hai04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    109381262 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase FRB_dom DUF3385 FATC TPR_19 Nipped-B_C UME
Other DBs
NCBI-GeneID: 109381262
NCBI-ProteinID: XP_019495297
LinkDB
Position
Un
AA seq 1646 aa
MIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSL
SHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVK
SHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMH
DNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVDRLTE
SLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRI
NHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHVSTIN
LQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVS
CWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLG
ERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELE
IQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLV
NDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCI
DKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQ
GCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQ
LDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELH
KLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHY
KHQNQARDEKKKLRHTSGANITSAATAATTAATATATATSTEGSNSESEAESSENSPTPS
PLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEAL
VEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKST
TTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERN
VKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDL
YYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVI
TSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQ
RYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQK
VEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSN
LMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTV
MEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVEL
GEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPT
QVELLIKQATSHENLCQCYIGWCPFW
NT seq 4941 nt   +upstreamnt  +downstreamnt
atgatcgaccagtcccgggatgcttctgctgtcagcctgtcagaatccaagtccagccag
gattcctctgactacagcaccagtgaaatgctggtcaacatgggaaacctgcccctggac
gagttctaccccgccgtgtccatggtggcgctgatgcggatcttccgggaccagtccctt
tctcaccatcacaccatggttgtccaggccatcaccttcatcttcaagtccctggggctc
aagtgtgtgcagttcctgccccaggtcatgcccacattcctgaatgtcattcgggtctgc
gacggggccatccgggaatttctgttccaacagctgggaatgttggtgtcatttgtgaag
agccacatcagaccttatatggatgaaatcgtcacccttatgagagagttctgggtcatg
aacacctcaatccagagcacgatcattcttctcattgagcaaattgtggtagctcttggg
ggtgaatttaagctctacctgcctcagctgattccacacatgttgcgcgtcttcatgcat
gataacagcccaggccgcatcgtctccatcaagttgctggctgcaatccagctgtttggc
gccaacctggatgactatctacatttgttgttgccccctatcgtgaagttgtttgatgcc
cctgaagttccactgccatctcgaaaggcagccttagagacagtggaccgcctgacggag
tccctggatttcaccgactatgcctcccggatcattcacccaattgttcggacgctggac
cagagcccagaactgcgccccacagccatggacacgctgtcttcactcgtctttcagctt
gggaagaagtaccaaattttcattccaatggtgaataaagttctggtgcgacaccgaatc
aaccatcagcgctatgatgtcctcatctgcaggattgtcaagggctacacccttgccgat
gaagaggaggaccctttgatttaccagcatcgaatgctgaggagtggccagggggatgca
ttggctagtgggccagtggaaacaggacccatgaagaaactgcacgtcagcaccatcaac
ctccaaaaggcctggggagctgccagaagggtctccaaagatgactggctggaatggctg
aggcggctaagcctggagctgttaaaggactcctcgtcgccctccctgcgctcatgctgg
gccctggctcaggcctacaaccctatggccagggatctcttcaatgctgcatttgtgtcc
tgctggtctgaactgaatgaagaccaacaggatgaactcatcagaagcatcgagttggcc
ctcacctcacaggacatcgctgaagtcacacaaaccctcttgaacttggctgaattcatg
gaacacagtgacaagggccccctgccactgagagacgacaatggcattgttttgctgggt
gagagggctgctaagtgccgagcatacgccaaagcgctacactacaaagaactggagttc
cagaaaggtcccacccctgccatcctagagtctctcatcagcattaataataagctacag
cagccggaggcagctgccggggtgttagaatatgccatgaaacacttcggagagttggag
atccaggctacctggtacgagaaactgcacgagtgggaggacgcccttgtagcctatgat
aagaaaatggacaccaacaaggatgacccagagctgatgctgggccgcatgcgctgcctc
gaggccttgggggaatgggggcagctccatcagcagtgctgtgaaaagtggaccctggtt
aacgatgagacccaagccaagatggcccgaatggctgctgcagctgcatgggggttaggt
cagtgggacagcatggaagagtacacctgtatgatccctcgggatactcatgatggggca
ttttatagagctgtgctggcattacatcaggacctcttctccctggcacaacagtgcatt
gacaaagccagggacctgctggatgcagagctaacggccatggcaggagagagctacagc
cgggcatatggggccatggtttcttgccatatgctctccgagctggaggaggtcatccag
tacaaacttgtccccgagcgacgagagatcatccgccagatctggtgggagagactgcag
ggctgccagcgcatcgtggaggactggcagaaaatcctcatggtgcggtcccttgtggtc
agcccccacgaggacatgaggacctggctcaagtatgcaagtctgtgtggcaagagcggc
aggctggctcttgctcataaaaccttagtgttgctcctgggagtcgatccgtctcggcag
cttgaccatcctctgccaacagttcaccctcaagtgacctacgcctacatgaaaaacatg
tggaagagtgctcgcaagattgatgccttccagcacatgcagcacttcgttcagaccatg
cagcagcaggcccagcatgccatcgccaccgaggaccagcagcacaagcaagagctgcac
aagctcatggcccgttgtttcctgaaacttggggagtggcagctgaacctccagggcatc
aacgagagcaccatccccaaagtcctgcagtattacagcgctgccacggagcacgaccgc
agctggtacaaggcctggcacgcgtgggcagtgatgaatttcgaagccgtgctgcactac
aaacaccagaaccaggcccgggacgagaagaagaagctgcgtcacaccagtggggccaac
atcaccagtgcggccacagccgccaccacggcggccacggccaccgccactgccaccagc
accgagggcagcaacagcgagagcgaggccgagagcagcgagaacagcccgacgccctct
cccctgcagaagaaggtcactgaggacttgtccaaaaccctcttgatgtacactgtccct
gccgtccagggcttcttccgttctatctccttgtcacgaggcaacaacctccaggatacg
ctcagagttctcaccttatggtttgattatggtcactggccagatgtaaatgaagccttg
gtggaaggggtgaaagcaatccagattgacacttggttacaggttatacctcagcttatt
gcaagaattgatacacccaggcccttggtgggacgtctcattcaccagcttctcacagac
attggtcggtaccacccccaggcactcatctaccccctgactgtggcttctaagtcgacc
accacagcccgtcacaacgcagccaacaagattctgaagaacatgtgtgagcacagtaac
accttggtgcagcaggccatgatggtgagtgaggagctgatccgagtggccatcctctgg
catgagatgtggcacgaaggcctggaggaagcttctcgtttgtactttggggagaggaac
gtgaaaggcatgtttgaggtgctggagcccctgcacgccatgatggaacgaggaccccag
actctgaaggaaacctcctttaaccaggcatatggtcgggatttaatggaggcccaagag
tggtgccggaaatacatgaaatcggggaatgtcaaggacctcacccaagcctgggacctc
tattatcacgtgttcagacgaatctcaaagcagctgccacagctcacatccttagagctg
cagtatgtttcccccaaacttctgatgtgccgtgaccttgagttggctgtgccaggaacc
tatgaccccaaccagccgatcattcgcattcagtccatagcaccatctctgcaagtcatc
acgtccaagcagaggccccggaagttgacacttatgggcagcaacgggcacgagtttgtc
ttcctcctgaagggccatgaagacctgcggcaggacgaacgagtgatgcagctcttcggc
ctggtcaacacccttctggccaacgacccaacctctctccggaaaaacctcagcatccag
agatacgcagtcattcccttatcaaccaactcgggcctcatcggctgggtcccccactgt
gacacgctgcacgccctcatccgggactacagggagaaaaagaagatccttctcaacatt
gagcatcgcatcatgttgcggatggctccagactacgatcacctgactctgatgcagaag
gtagaggtgtttgagcacgctgtcaataacacagcgggggacgacctggccaagctgctg
tggctgaaaagccccagctccgaggtgtggtttgatcgaagaaccaattacacccgctct
ttagcagtcatgtccatggtcgggtatattttgggcctgggagatagacacccatccaac
ctgatgctggaccggctgagtgggaagatcctgcacattgactttggggactgctttgag
gttgctatgaccagagagaaatttccagaaaagattccgtttagactaacgagaatgttg
accaacgctatggaggttaccggtctggatggcaactacagaatcacgtgccacacagtg
atggaagttcttcgggaacacaaggatagtgtcatggctgtgctggaagcctttgtctac
gaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaagcgatcccga
acaaggacagattcctactctgctggccagtccgtagaaattttggatggtgtggaactt
ggggaaccagcccataagaaaacggggaccacagtgccagaatctattcattctttcatt
ggagatggcctggtcaaacctgaggccctaaataagaaagctattcaaattattaacaga
gttcgagataagctcactggtcgggacttctctcatgatgaaacgttggatgtcccaaca
caagttgagctgctcatcaaacaagcaacgtcccatgaaaacctctgccagtgctacatt
ggctggtgtcctttctggtaa

DBGET integrated database retrieval system