KEGG   Hipposideros armiger (great roundleaf bat): 109381302
Entry
109381302         CDS       T04661                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01524  Platinum drug resistance
hai04115  p53 signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04215  Apoptosis - multiple species
hai04370  VEGF signaling pathway
hai04919  Thyroid hormone signaling pathway
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05014  Amyotrophic lateral sclerosis
hai05016  Huntington disease
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05134  Legionellosis
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05210  Colorectal cancer
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05215  Prostate cancer
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109381302 (CASP9)
   04151 PI3K-Akt signaling pathway
    109381302 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109381302 (CASP9)
   04215 Apoptosis - multiple species
    109381302 (CASP9)
   04115 p53 signaling pathway
    109381302 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109381302 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381302 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109381302 (CASP9)
   05212 Pancreatic cancer
    109381302 (CASP9)
   05215 Prostate cancer
    109381302 (CASP9)
   05213 Endometrial cancer
    109381302 (CASP9)
   05222 Small cell lung cancer
    109381302 (CASP9)
   05223 Non-small cell lung cancer
    109381302 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109381302 (CASP9)
   05012 Parkinson disease
    109381302 (CASP9)
   05014 Amyotrophic lateral sclerosis
    109381302 (CASP9)
   05016 Huntington disease
    109381302 (CASP9)
   05020 Prion disease
    109381302 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    109381302 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109381302 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    109381302 (CASP9)
   05152 Tuberculosis
    109381302 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109381302 (CASP9)
   05162 Measles
    109381302 (CASP9)
   05164 Influenza A
    109381302 (CASP9)
   05161 Hepatitis B
    109381302 (CASP9)
   05160 Hepatitis C
    109381302 (CASP9)
   05168 Herpes simplex virus 1 infection
    109381302 (CASP9)
   05163 Human cytomegalovirus infection
    109381302 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109381302 (CASP9)
   05169 Epstein-Barr virus infection
    109381302 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109381302 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109381302 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hai01009]
    109381302 (CASP9)
   01002 Peptidases and inhibitors [BR:hai01002]
    109381302 (CASP9)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     109381302 (CASP9)
Protein phosphatases and associated proteins [BR:hai01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109381302 (CASP9)
Peptidases and inhibitors [BR:hai01002]
 Cysteine peptidases
  Family C14: caspase family
   109381302 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 109381302
NCBI-ProteinID: XP_019495384
LinkDB
Position
Un
AA seq 445 aa
MDVADRQVLRRCRVRLVSELQVAPLWDALLSRELFTPGMIEDIQQAGSKSRGDQARQLVT
DLETRGSQALPLFISCLEDTGQNSLASLLRTSSQAAKRDPEAIRPLDLMPVVLKPEELSV
VKPDPLKPTPGKLTAAVLGPEELGPTKLRPEVLRPEVPRPEDIGAGGFSDVRAQIGSRGN
ADLAYILNAEPCGHCLIINNVDFSFGLSTRFGSDIDCEKLQRRFRSLHFLVEVKHNLTSK
QMVHALVELARRDHGALDCCVVIILSHGCEASHRQFPGAVYGTDGYPVSIERIVNIFNGT
GCPSLGGKPKLFFIQACGGDQKDHGFEVASASPEDRAPDSNPEPDAAPFQDDPGSYDLPD
AVSSLPTPSDIFVSYSTFPGFVSWRERKSGSWYIETLDSVFEQWARSEDLQSLLLRVANA
VSEKGIYKQIPGCFNFLRKKLFFKT
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggacgtcgctgaccggcaggtcctgcggcggtgtcgggtgcggctggtcagcgagctg
caggtggcccctctctgggacgctctgctgagccgcgagctcttcacgcccggcatgatc
gaggacatccagcaggcaggctctaagtcccggggcgatcaggccaggcagctggtcaca
gacctggagactcgagggagtcaggcccttcctttgttcatctcctgcttagaggacaca
ggccagaacagcctggcgtcattgctgagaacgagtagccaagcagcaaagcgggatccg
gaggccatcaggcccttggacctcatgcctgtggtgctcaaaccagaggagctgagcgtg
gtgaagccggatccattgaagccgaccccaggaaaactcactgcagccgtgctggggcca
gaggagctcgggcccaccaagctcaggccagaggttctcagaccagaggtgcccaggcca
gaggacattggtgctggaggattcagtgatgtccgtgctcagataggatccagggggaat
gccgatttggcatacattctgaacgcagaaccctgtggccactgccttattatcaacaac
gtggacttcagctttgggcttagcacccgcttcggctccgatatcgactgtgagaagctg
cagcgacgtttccgctcgctacatttcttggtggaggtgaagcacaacctgactagcaag
caaatggtccatgctttggtggagctggcacggcgggaccatggcgctctggactgctgt
gtggtgatcatcctctctcacggctgtgaggccagccaccgccagttcccgggggctgtt
tatggcacagatgggtatcccgtgtccatcgagagaattgtgaacatcttcaatggaacc
ggctgccccagcttgggagggaagcccaaactctttttcatccaggcctgtggtggagat
cagaaagaccatgggtttgaggtggcctctgcttcccctgaggacagggcccctgacagt
aaccctgagccagacgctgctccgttccaggatgacccaggcagctacgacctgccggat
gctgtgtccagtctgcctacacccagtgacatctttgtgtcctactccaccttcccaggt
tttgtctcctggagggagcgcaagagcggctcctggtacatcgagaccctggatagcgtt
tttgagcagtgggctcgctctgaagacctgcagagcctcctgctcagggttgctaatgct
gtttcggagaaagggatttacaaacagattcctggttgtttcaatttcctccggaaaaaa
ctcttctttaaaacttaa

DBGET integrated database retrieval system