KEGG   Hipposideros armiger (great roundleaf bat): 109381350Help
Entry
109381350         CDS       T04661                                 

Gene name
NOTCH1
Definition
(RefSeq) notch 1
  KO
K02599  Notch 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01522  Endocrine resistance
hai04330  Notch signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04919  Thyroid hormone signaling pathway
hai05020  Prion diseases
hai05165  Human papillomavirus infection
hai05200  Pathways in cancer
hai05206  MicroRNAs in cancer
hai05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    109381350 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109381350 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109381350 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381350 (NOTCH1)
   05206 MicroRNAs in cancer
    109381350 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    109381350 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    109381350 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109381350 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109381350 (NOTCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Ank_2 DUF3454 Notch Ank NOD NODP Ank_5 Ank_4 Ank_3 EGF_3
Motif
Other DBs
NCBI-GeneID: 109381350
NCBI-ProteinID: XP_019495471
LinkDB All DBs
Position
Un
AA seq 2533 aa AA seqDB search
MPPLLAPLLCLALLPALGARGLRCSQPSETCLNGGKCEVFPNGTEACVCSGAFVGQRCQA
HDPCLSTPCKNAGTCLVVDRGGVVDYTCSCRLGFSGPLCLTPQDNACLANPCRNGGTCDL
LTLTEYKCRCPPGWSGKTCQQADPCASNPCANGGQCLPFEASYICGCPSGFHGSTCRQDV
NECNQNSGPCHNGGTCLNEIGSFRCLCRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDT
THECACLPGFTGQNCEENIDDCPGNRCQNGGTCVDGVNTYNCRCPPEWTGQYCTKDMDEC
QLMPNACQNGGTCHNSHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYC
ECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLG
ANPCEHKGKCINTLGSFECQCLQGYSGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICM
PGYEGVHCEVNKDECASSPCLQNGRCLDKINEFLCECPTGFTGNLCQYDVDECASTPCKN
GAKCLDGPNTYSCMCTEGYTGPHCEVDIDECDPDPCHYGSCKDGIATFTCLCQPGYTGHH
CETNINECHSQPCRHGGTCQDRDNAYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKI
DGYECACEPGYTGSMCNINIDECAGNPCHNGGTCQDGINSFACRCPEGYHGPTCLSEVNE
CDSNPCIHGACRDSLNGYKCDCDPGWSGANCDVNNNECESNPCINGGACKDMTSGYVCTC
REGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPGPCR
NGGECKASEDYESFSCVCPTGWQGQTCEIDINECVKSPCRNGASCQNTNGSYRCHCQAGY
TGRNCETDIDDCRPNPCHNGGSCTDGINMAYCDCLAGFQGAFCEEDINECASSPCRNGAN
CTDCVASYTCTCPTGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQ
HDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNA
LYRCECHSGWTGLYCDVPSVSCEVAAWRQGIEVTNLCRNGGLCMDAGNTHHCRCQAGYTG
SYCEDQVDECSPSPCQNGATCTDYPGGYSCECVAGYHGVNCSEEINECLSHPCQNGGTCI
DLTNTYKCSCPRGTQGVHCEVNVDDCSPPIDPVSRGPKCFNNGTCVDQVGGYSCTCLPGF
VGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNG
GTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFT
GPECQFPASSPCVGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFRGGVGLD
ITPPQIEEACELPECREEAGNKVCSLQCNNHACGWDGGDCSLNFNDPWQNCTQSLECWKY
FSNDHCDSQCNSAGCLFDGFDCQRADGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGL
DCADHVPERLATGTLVVVVLMPPDQLRNGSLHFLRELSRLLHTNVVFKRDANGRQMIFPY
YGHEEELHKHPIKRSVEGWAAPSALLGQVKAALLPDGSSGRWRRELDPMEIRGSIVYLEI
DNRQCVQSSSQCFQSATDVAAFLGALALRGNLNIPYKIEAVQSETVEPPPPPPLHFMYVA
VVAFVLLVFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNA
SDGALMDDNQNEWGDEDLESKKFRFEEPVVLPDLDAQTDHRQWTQQHLDAADLRVSAMAP
TPPQGEADADCMDVNVRGPDGFTPLMIASCSGGGLETGNSDEEEDAPAVISDFIYQGASL
HNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNN
VEAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHLANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYSLVHSPALHGANLGGAPTLSPPLCSPNGYLGNLKPTVQGKKARK
PSTKGLAGGGKETRDLKARRKKSQDGKGCLLDSASVLSPVDSLESPHGYLSDVASPPLLP
SPFQQSPSMPLNHLPGMPDTHLGISHLSVAAKPEMAALGGGGRLAFEAGPPRLSHLPVAS
STSTVLGTGGGSGAVNFTVGGTTGLNGQCEWLSRLQNGLVPNQYNPLRGSVAPGTLSTQA
PALQHGMMGPLHGGLSASALSHMLSYQALPNTRLATQPHLVQTQVQQQPPSIPPHLSVSS
AANGHMGRSFLGGEPSQADVQSLGPSGLAVHTILPQDSQVLPTSLPSSLVPPMTTAQFLT
PPSQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTS
MQSQIPHIPEAFK
NT seq 7602 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgctcctggcgcccctgctctgcctggcgctgctgcccgcgctcggcgcacga
ggcctgcggtgttcccagcccagcgagacctgcttgaatggcgggaagtgtgaagtgttc
cccaacggcaccgaggcctgtgtctgcagcggggccttcgtgggccagcgatgccaggcg
cacgatccctgcctcagcaccccctgcaagaatgccgggacgtgcctcgtggtggaccgt
ggtggtgtggtggactacacctgcagctgccgcctgggtttctccgggcctctctgcctg
acaccccaagacaacgcctgtctcgccaacccctgccgcaacggtggtacctgcgacctg
ctgacgctcacggagtacaagtgccgctgtcccccgggctggtcagggaagacgtgccag
caggctgacccgtgtgcctccaacccctgtgccaacggcggccagtgcctgcctttcgag
gcctcatacatctgcggctgcccgtccggtttccacggctccacctgcaggcaggacgtg
aacgaatgcaaccagaactccgggccctgccacaatgggggcacctgcctcaacgagatc
ggttccttccgctgcctgtgccgggccacccacaccggcccccactgcgagctgccctac
gtgccctgcagcccctctccctgccagaacgggggcacctgccgccccacgggggacacc
acccacgagtgcgcctgcctgccagggtttactggtcagaactgtgaagaaaatattgac
gactgtccaggaaacaggtgccagaatgggggcacctgtgtggatggggtgaacacctac
aactgccgctgcccgccagagtggacaggccagtactgcaccaaggacatggacgagtgc
cagcttatgcccaacgcctgccagaacggtgggacgtgccacaactcccacggtggctac
aactgcgtgtgcgtcaacggctggaccggcgaggactgcagcgagaacatcgacgactgt
gccagtgccgcctgcttccatggtgccacctgccatgaccgtgtggcctccttctactgc
gagtgtccccacggccgcacaggtctgctgtgccacctcaatgacgcttgcatcagcaac
ccctgcaatgagggctccaactgtgacaccaaccccgtcaacggcaaggccatttgtacc
tgtccctcggggtacacaggaccagcttgcagccaggacgtggacgagtgctcactgggt
gccaacccctgtgagcacaagggcaagtgtatcaacacgctgggctccttcgagtgccag
tgtctgcagggctacagcggtcctcgctgtgagattgacgtcaacgagtgcgtctcaaac
ccatgtcagaacgacgccacctgcctggaccagatcggggagttccagtgtatctgcatg
cctggctatgagggcgtgcactgtgaggtgaacaaggacgaatgtgccagcagcccctgc
ctccagaacggacgctgcctggacaagatcaatgagttcctgtgcgagtgtcccacaggc
ttcaccgggaacctgtgccaatacgacgtggacgagtgtgcaagcactccctgcaagaat
ggcgccaagtgcctggacgggcccaacacctacagctgcatgtgcacagaaggctacaca
gggccccactgcgaggtggacatcgacgagtgtgaccctgacccctgccactacgggtcc
tgcaaggacggcatcgccaccttcacctgcctgtgccagccgggctacacaggccaccat
tgcgagaccaacatcaacgagtgccacagtcagccctgccgccacgggggcacctgccag
gaccgtgacaacgcctacctctgtctctgcctcaaggggaccacaggacccaactgtgaa
atcaacctggacgactgtgccagcaacccctgcgactcgggcacctgtctggacaagatt
gacggctacgagtgtgcatgtgagccgggctacacaggaagcatgtgcaatatcaacatt
gatgagtgtgccggcaacccctgccacaatgggggcacctgccaggatggcatcaacagc
ttcgcctgccgctgccctgagggctaccatggccccacgtgcctgtctgaggtcaacgag
tgcgacagcaacccctgcatccacggggcctgccgggacagcctcaatgggtataagtgt
gactgtgaccctgggtggagtggggccaactgtgacgtgaacaacaatgagtgtgagtcg
aacccctgcatcaatggcggtgcctgcaaggacatgaccagtggctatgtgtgtacctgc
cgggaaggcttcagtggccccaactgccagaccaacattaacgagtgcgcgtccaacccg
tgtctgaaccagggcacgtgtatcgatgacgtggcgggttacaaatgcaactgcctgctg
ccctacacgggagccacatgtgaggtggtgctggccccgtgtgcccccggcccctgcaga
aatggcggcgaatgcaaggcgtctgaggactacgagagcttttcctgcgtctgccccacc
ggctggcaggggcagacctgtgagatcgacatcaacgagtgtgtgaagagcccgtgccgc
aacggtgcctcctgccagaacaccaacggcagttaccgctgccactgccaagcaggttac
acggggcgcaactgcgagacggacatcgacgactgccggccgaacccatgtcacaatggt
ggctcctgcacagacggcatcaacatggcctactgcgactgcctagctggcttccagggc
gccttctgcgaggaggacatcaacgaatgtgccagcagcccctgtcgcaatggcgccaac
tgcaccgactgtgtggccagctatacgtgcacctgccccacaggctttagcgggatccac
tgtgagaacaacacacctgactgcacggagagctcctgcttcaatggtggcacctgcgtg
gatggcatcaactccttcacttgcctgtgcccgcctggcttcacgggcagctactgccag
cacgacgtcaatgagtgtgactcgcgtccctgcctgcacggtggcacctgtcaagatagc
tatggcacctacaagtgcacctgcccacagggctataccggcctcaactgccagaacctt
gtacgctggtgcgactcctcaccctgcaagaacggcggcaagtgctggcagaccaacgcc
ctgtatcgctgtgagtgccacagcggctggactggcctctactgtgacgtgcccagcgtt
tcctgtgaagtggccgcatggcggcaaggcatcgaagtgaccaacctatgccggaacgga
gggctctgcatggatgcaggcaacacgcaccactgccgctgccaggcgggctacacgggc
agctactgtgaggaccaggtggacgagtgctcacctagcccctgccagaacggggccacc
tgcaccgactaccctggcggctactcctgtgagtgtgtggccggctaccatggggtgaat
tgctctgaggagatcaatgagtgcctgtcccacccgtgccagaacgggggtacctgcatc
gacctcaccaacacatacaagtgttcctgtccccggggcacacagggtgtgcactgtgag
gtcaatgtggatgactgcagcccccccatcgaccccgtctcccggggccccaagtgcttc
aacaatggcacatgcgtggaccaggtgggcggctacagctgcacctgcctgcccggcttt
gtgggcgagcgctgcgagggcgacgtcaacgagtgcctgtccaacccctgcgatgcccgc
ggcacccagaactgcgtgcagcgtgtcaacgacttccactgcgagtgtcgggccggccac
accgggcgccgctgtgagtctgtcatcaacggctgcaaaggaaagccatgcaagaacggg
ggcacgtgtgcagtggcctccaacaccgcccgcgggttcatctgcaaatgcccagcgggc
ttcgagggcgccacgtgtgagaacgacgcgcgcacctgcggcagcctgcggtgcctcaac
ggcggcacctgcatctcgggcccgcgcagccccacctgcctgtgcctgggccccttcacc
ggccccgagtgccagttcccggccagcagcccctgcgtgggcggcaacccctgctacaac
cagggcacgtgcgagcccacttccgagagccctttttaccgctgtctatgtcctgccaag
ttcaacgggctcctgtgccacatcctggactatagcttcaggggcggcgtgggcctggac
atcaccccaccgcagatcgaggaggcctgcgagctccccgagtgccgtgaggaggccgga
aacaaggtctgcagcctgcagtgtaacaaccacgcgtgtggctgggacggcggcgactgc
tccctcaacttcaacgacccttggcagaactgcacacagtcgctggagtgctggaagtat
ttcagcaacgaccactgcgacagccagtgcaactcggccggctgcctctttgacggcttc
gactgccagcgcgccgacggccagtgcaaccccctgtatgaccagtactgcaaggaccac
ttcagcgacgggcactgcgaccagggctgcaacagcgcagagtgtgagtgggacgggtta
gactgtgcagatcacgtgcccgagcggctggccactggcacgctggtggtggtggtgctg
atgccaccggaccagctgcgcaacggctccctgcatttcctgcgggagctcagccgcctg
ctgcacaccaacgtggtcttcaagcgtgacgcgaacggccggcagatgattttcccctac
tacggccatgaggaggagctgcacaagcaccccatcaaacgctctgtggaaggctgggct
gcgcccagcgccctgctcggccaggtgaaggctgcattactcccagatggcagcagtggg
cgctggcgcagggagctggacccaatggagatccgcgggtccattgtctatctggagatt
gacaaccggcagtgcgtccagtcgtcctcccagtgcttccagagtgccacggacgtggct
gcgttcctgggggcgctcgccttgcggggcaacctgaacatcccctacaagatcgaggct
gtgcagagtgagacggtggagccgccaccgcccccgccgctgcacttcatgtacgtggcc
gtggtcgccttcgtccttctcgtcttcgtgggctgcggggtgctgctgtctcgaaagcgt
cggcggcagcatggccagctctggttccctgagggcttcaaggtgtcggaggccagcaag
aagaagcggcgggagcccctcggagaggactccgtgggcctcaagcccctgaagaatgcc
tcagacggtgccctcatggatgacaaccagaacgagtggggtgacgaggacctagagagc
aagaagttccggtttgaggagccagtggttctccccgacctggatgcccagacagaccac
cggcagtggacccagcagcacttggatgctgccgacctgcgcgtgtccgccatggccccc
acaccgccccagggtgaggctgacgccgactgcatggacgtcaacgtccgcgggccggat
ggcttcacgcccctcatgatcgcctcctgcagtggagggggcctggagacgggcaacagc
gatgaggaggaggacgcgcctgccgtcatctcagacttcatctaccagggtgccagtctg
cacaaccagacggaccgcacgggtgagaccgccctgcacctggctgcccgctactcacgc
tctgacgcggccaagcgcctgttggaggccagcgccgacgccaacatccaggacaacatg
ggacgcacgccgctacacgcggccgtgtctgccgacgcacagggtgttttccagatcctg
atccggaaccgagccacagacctggacgcccgcatgcacgatggcacgacgcccctgatc
ttggccgcccgcctggccgtggagggcatgctggaagacctcatcaactcgcacgccgac
gtcaatgccgtggacgacttgggcaagtccgccctgcactgggctgccgccgtgaataac
gtggaggccgccgtcgtgctcctgaagaacggtgccaacaaggacatgcagaacaacaag
gaggagacgcctctgttcctggccgcccgggagggcagctacgagaccgccaaggtgctg
ctggaccacctggccaaccgggacatcaccgaccacatggatcgcctgccccgcgacatc
gcgcaggagcgaatgcaccacgacatcgtgcggctgctggacgagtacagcctggtgcac
agccccgcactgcacggcgccaacctgggtggcgcgcctaccctgtcacccccactctgc
tcgcccaacggctacctgggcaacctcaagcccaccgtgcagggcaagaaggcccgcaag
cccagcaccaagggcctggccgggggcggcaaggagaccagggacctgaaagcacggagg
aagaagtcccaggatggcaagggctgcctactagacagcgcgagcgtgctgtctcctgtg
gactcccttgagtcgccccacggctacctgtcggacgtggcctcgccacccctcctgccc
tcccccttccagcagtctccatctatgcccctcaaccacctgcctggcatgcccgacacc
cacctgggcatcagccacctgagtgtggcggccaagcccgagatggcagcgctgggcggg
ggtggccggctggccttcgaggcagggccgccacgcctctcccacctgcctgtggcctcc
agcaccagcactgtcctgggtaccggcggtggcagcggggccgtaaatttcaccgtgggt
gggaccacgggcttgaacggccagtgcgagtggttgtcgcggctgcagaacggcctggtg
ccaaaccagtacaacccgctgcgagggagcgtggccccaggcacactgagcacacaggcc
ccggccctccagcacggcatgatgggcccgctgcacggcggcctctctgccagcgccctg
tcccacatgctgagctaccaggccctgcccaacacacggctggccacccagcctcacctg
gtgcagacccaggtgcagcagcagccgccaagcatcccgccacacctcagcgtgagctcg
gccgccaacggccacatgggccggagcttcctgggcggggagccaagccaggcagacgtg
cagtcgctgggccccagcggcctggccgtgcacaccatcctgccgcaggacagccaggtc
ctgcccacctcactgccatcttctctggtcccacccatgaccactgcccagttcctgacg
ccgccctcgcagcacagctattcctcttcgcctgtggacaacacccccagccaccagctg
caggtgcccgagcacccctttctcaccccgtccccggagtcgcctgaccagtggtccagc
tcgtccccacattccaacatctccgattggtccgagggcatctccagcccgcccaccagc
atgcagtcgcagatcccccacattccggaggcgttcaagtaa

DBGET integrated database retrieval system