KEGG   Hipposideros armiger (great roundleaf bat): 109381354
Entry
109381354         CDS       T04661                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01524  Platinum drug resistance
hai04115  p53 signaling pathway
hai04210  Apoptosis
hai04215  Apoptosis - multiple species
hai04932  Non-alcoholic fatty liver disease
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05014  Amyotrophic lateral sclerosis
hai05016  Huntington disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05132  Salmonella infection
hai05134  Legionellosis
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05210  Colorectal cancer
hai05222  Small cell lung cancer
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109381354
   04215 Apoptosis - multiple species
    109381354
   04115 p53 signaling pathway
    109381354
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381354
  09162 Cancer: specific types
   05210 Colorectal cancer
    109381354
   05222 Small cell lung cancer
    109381354
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109381354
   05012 Parkinson disease
    109381354
   05014 Amyotrophic lateral sclerosis
    109381354
   05016 Huntington disease
    109381354
   05017 Spinocerebellar ataxia
    109381354
   05020 Prion disease
    109381354
   05022 Pathways of neurodegeneration - multiple diseases
    109381354
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109381354
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109381354
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109381354
   05134 Legionellosis
    109381354
   05152 Tuberculosis
    109381354
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109381354
   05162 Measles
    109381354
   05164 Influenza A
    109381354
   05161 Hepatitis B
    109381354
   05160 Hepatitis C
    109381354
   05168 Herpes simplex virus 1 infection
    109381354
   05163 Human cytomegalovirus infection
    109381354
   05167 Kaposi sarcoma-associated herpesvirus infection
    109381354
   05169 Epstein-Barr virus infection
    109381354
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109381354
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109381354
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 109381354
NCBI-ProteinID: XP_019495477
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GDDTLMEYLENPKKYIPGTKMIFAGIKKTAERADLIAYLKKATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgtagagaagggcaagaagatttttgtgcagaaatgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag
actggtcaggcccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagatgacaccttgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagactgcagaaagggcagacttgatagcgtatctcaaa
aaggctactaaggagtaa

KEGG   Hipposideros armiger (great roundleaf bat): 109393551
Entry
109393551         CDS       T04661                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01524  Platinum drug resistance
hai04115  p53 signaling pathway
hai04210  Apoptosis
hai04215  Apoptosis - multiple species
hai04932  Non-alcoholic fatty liver disease
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05014  Amyotrophic lateral sclerosis
hai05016  Huntington disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05132  Salmonella infection
hai05134  Legionellosis
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05210  Colorectal cancer
hai05222  Small cell lung cancer
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109393551
   04215 Apoptosis - multiple species
    109393551
   04115 p53 signaling pathway
    109393551
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109393551
  09162 Cancer: specific types
   05210 Colorectal cancer
    109393551
   05222 Small cell lung cancer
    109393551
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109393551
   05012 Parkinson disease
    109393551
   05014 Amyotrophic lateral sclerosis
    109393551
   05016 Huntington disease
    109393551
   05017 Spinocerebellar ataxia
    109393551
   05020 Prion disease
    109393551
   05022 Pathways of neurodegeneration - multiple diseases
    109393551
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109393551
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109393551
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109393551
   05134 Legionellosis
    109393551
   05152 Tuberculosis
    109393551
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109393551
   05162 Measles
    109393551
   05164 Influenza A
    109393551
   05161 Hepatitis B
    109393551
   05160 Hepatitis C
    109393551
   05168 Herpes simplex virus 1 infection
    109393551
   05163 Human cytomegalovirus infection
    109393551
   05167 Kaposi sarcoma-associated herpesvirus infection
    109393551
   05169 Epstein-Barr virus infection
    109393551
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109393551
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109393551
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 109393551
NCBI-ProteinID: XP_019518462
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKTAERADLIAYLKKATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgtagagaagggcaagaagatttttgtgcagaaatgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag
actggtcaggcccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggacaccttgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagactgcagaaagggcagacttgatagcgtatctcaaa
aaggctactaaggagtaa

DBGET integrated database retrieval system