KEGG   Hipposideros armiger (great roundleaf bat): 109381671
Entry
109381671         CDS       T04661                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03050  Proteasome
hai04060  Cytokine-cytokine receptor interaction
hai04066  HIF-1 signaling pathway
hai04217  Necroptosis
hai04350  TGF-beta signaling pathway
hai04380  Osteoclast differentiation
hai04612  Antigen processing and presentation
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04657  IL-17 signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04940  Type I diabetes mellitus
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05143  African trypanosomiasis
hai05144  Malaria
hai05145  Toxoplasmosis
hai05146  Amoebiasis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05200  Pathways in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05321  Inflammatory bowel disease
hai05322  Systemic lupus erythematosus
hai05323  Rheumatoid arthritis
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    109381671 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109381671 (IFNG)
   04630 JAK-STAT signaling pathway
    109381671 (IFNG)
   04066 HIF-1 signaling pathway
    109381671 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109381671 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109381671 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109381671 (IFNG)
   04612 Antigen processing and presentation
    109381671 (IFNG)
   04660 T cell receptor signaling pathway
    109381671 (IFNG)
   04658 Th1 and Th2 cell differentiation
    109381671 (IFNG)
   04659 Th17 cell differentiation
    109381671 (IFNG)
   04657 IL-17 signaling pathway
    109381671 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109381671 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381671 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109381671 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109381671 (IFNG)
   05323 Rheumatoid arthritis
    109381671 (IFNG)
   05321 Inflammatory bowel disease
    109381671 (IFNG)
   05330 Allograft rejection
    109381671 (IFNG)
   05332 Graft-versus-host disease
    109381671 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109381671 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109381671 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109381671 (IFNG)
  09172 Infectious disease: viral
   05164 Influenza A
    109381671 (IFNG)
   05160 Hepatitis C
    109381671 (IFNG)
   05168 Herpes simplex virus 1 infection
    109381671 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109381671 (IFNG)
   05144 Malaria
    109381671 (IFNG)
   05145 Toxoplasmosis
    109381671 (IFNG)
   05140 Leishmaniasis
    109381671 (IFNG)
   05142 Chagas disease
    109381671 (IFNG)
   05143 African trypanosomiasis
    109381671 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hai03051]
    109381671 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109381671 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109381671 (IFNG)
Proteasome [BR:hai03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109381671 (IFNG)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interferons
   109381671 (IFNG)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Haparin
  Cytokines
   109381671 (IFNG)
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 109381671
NCBI-ProteinID: XP_019496069
LinkDB
Position
Un
AA seq 166 aa
MNYTSYILAFQLCVILGSSGCYCQTTVWKGIDYLKEYFNASNSDVADGGYLFLDILKNWK
EESDKKIIQSQIVSIYFKLFENMKDNELIKSSVAAIEEDLRVKFFNNSNRKLEDFKTLIQ
IPVDDLMVQRKAISELFNVITELEPKSNLRKRKRSQSLFRGRRASK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaattatacaagttatattttagcttttcagctttgcgtgattttaggttcttctggc
tgctactgccagactacagtttggaaaggaatagattacctaaaggaatattttaatgca
agtaattcagatgtagcggatggtggatatcttttcttagatattttgaagaattggaaa
gaggagagtgacaaaaaaataattcagagccaaattgtttccatctacttcaaactcttt
gaaaacatgaaagataatgagctcattaaaagtagcgtggcagctattgaggaagacctg
cgtgtcaaattcttcaataacagcaaccgtaaactggaagacttcaagacgctgattcaa
attccggtagatgatctgatggtccagcgcaaggccatatctgaactcttcaatgtgatc
actgaactggaaccaaaatctaacctaaggaagaggaaaaggagtcagagcctgtttcgt
ggtcggagagcatcaaaataa

DBGET integrated database retrieval system