KEGG   Hipposideros armiger (great roundleaf bat): 109381695
Entry
109381695         CDS       T04661                                 

Gene name
TBK1
Definition
(RefSeq) TANK binding kinase 1
  KO
K05410  TANK-binding kinase 1 [EC:2.7.11.10]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04014  Ras signaling pathway
hai04137  Mitophagy - animal
hai04140  Autophagy - animal
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04657  IL-17 signaling pathway
hai05014  Amyotrophic lateral sclerosis
hai05022  Pathways of neurodegeneration - multiple diseases
hai05135  Yersinia infection
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109381695 (TBK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109381695 (TBK1)
   04137 Mitophagy - animal
    109381695 (TBK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109381695 (TBK1)
   04621 NOD-like receptor signaling pathway
    109381695 (TBK1)
   04622 RIG-I-like receptor signaling pathway
    109381695 (TBK1)
   04623 Cytosolic DNA-sensing pathway
    109381695 (TBK1)
   04657 IL-17 signaling pathway
    109381695 (TBK1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109381695 (TBK1)
   05022 Pathways of neurodegeneration - multiple diseases
    109381695 (TBK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109381695 (TBK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109381695 (TBK1)
   05162 Measles
    109381695 (TBK1)
   05164 Influenza A
    109381695 (TBK1)
   05161 Hepatitis B
    109381695 (TBK1)
   05160 Hepatitis C
    109381695 (TBK1)
   05168 Herpes simplex virus 1 infection
    109381695 (TBK1)
   05163 Human cytomegalovirus infection
    109381695 (TBK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109381695 (TBK1)
   05169 Epstein-Barr virus infection
    109381695 (TBK1)
   05165 Human papillomavirus infection
    109381695 (TBK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109381695 (TBK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109381695 (TBK1)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     109381695 (TBK1)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109381695 (TBK1)
Membrane trafficking [BR:hai04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    109381695 (TBK1)
SSDB
Motif
Pfam: TBK1_CCD1 TBK1_ULD Pkinase PK_Tyr_Ser-Thr Pkinase_fungal DUF713 Kinase-like CEP63 ubiquitin
Other DBs
NCBI-GeneID: 109381695
NCBI-ProteinID: XP_019496101
LinkDB
Position
Un
AA seq 732 aa
MQSTSNHLWLLSDILGQGATANVFRGRHKRTGTKPFLQVWNNTFSLRLLQKLQQICISXK
PHHKNIVRLSFPITDFFFQTTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLR
DVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTE
EYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKI
ITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQ
FFAETSDILHRMIIHVFSLQQMTAHKIYIHSYNTATVFHELVYKQTKIISSNQELIYEGR
RLVLEPGRLAQHFPKTTEENPIFVVSREPLSTIGLLYEKISLPKVHPRYDLDGDASMAKA
ITGVVCYACRIASTLLLYQELMRKGIRWLIELVKDDYNETVHKKTEVVITLDFCIRNIEK
TVKVYEKLMKINLESAELDEISDIHTKLLRLSSSQGTIETSLQDTESKLSPGGLLADTWA
HQEGTHPKDRHVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYHHATKA
MTHFTDECVKKYEAFLDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQET
LPQKMFQASSGIKHTMTPIYPCSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSL
TMDGGLRNVDCL
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgcagagcacttctaatcatctgtggcttttatctgatattttaggccaaggagctact
gcaaatgtctttcgtggaagacataagcgcacaggtactaaacctttcctacaggtttgg
aataatacctttagtctccgtttacttcagaagttgcaacagatctgcatatcctaaaag
ccccatcataaaaacattgttagactgtcattcccaatcactgattttttttttcagaca
acaacaagacataaagtacttattatggaattttgtccatgtgggagtttatacactgtt
ttagaagaaccatctaatgcctatggactaccagagtctgaatttttaattgttttgcgc
gatgtggtgggtggaatgaatcatctccgagagaatggcatagtgcaccgtgatatcaag
ccgggaaatatcatgcgtgttataggggaagatggacagtcggtgtacaaactcacagat
tttggtgcagctagagaattagaagatgatgagcagtttgtttcactgtatggcacagaa
gaatatttgcatcctgatatgtatgagagagcagtgctaagaaaagatcatcagaagaaa
tatggagcaacagttgatctttggagcattggggtaacattttaccacgcagctactgga
tcactgccatttagaccatttgaagggccacgtaggaataaggaagtgatgtataaaata
attactggaaagccttctggtgcaatatctggagtacagaaagcagaaaatggaccaatt
gactggagtggagacatgcctgtttcttgtagtctttctcggggactgcaagttctactt
acccctgttcttgcaaacatccttgaggcagatcaggaaaagtgttggggttttgaccag
ttttttgcagaaactagtgatatacttcaccgcatgataattcatgttttttcactacaa
caaatgacagctcataagatttatattcatagctataatactgctactgtatttcatgaa
ctggtgtataaacaaaccaaaattatttcttcaaatcaagaacttatatatgaaggacga
cgcttagttctagaacctggaagactggcacaacatttccctaaaactactgaggaaaac
cctatctttgtagtaagccgagaacctctgagtaccataggattgttatatgaaaaaatt
tccctccctaaagtacatccgcgttatgatttagatggagatgctagcatggctaaggca
ataacaggagttgtatgttatgcctgtagaattgccagtaccttgctgctttatcaggaa
ctaatgcgaaaagggatacgatggctgatagaattagttaaagatgattataatgaaact
gttcacaaaaagacagaagttgtgatcacgttggatttctgcatcagaaacattgaaaaa
actgtgaaagtatatgaaaagctgatgaagatcaatttagaatcagcagagttagatgaa
atctcagacatacacaccaaattgttgagactttccagttctcagggaacaatagaaacc
agccttcaggataccgaaagcaaattatctccaggaggattgctggcggatacctgggcc
catcaggaaggcactcatccaaaagatagacatgtagaaaagctacaagtcctgttaaat
tgcatcacagagatttactatcagttcaaaaaagacaaagcagaacgtagactagcttat
aatgaagaacaaatccacaaatttgataagcaaaaactgtatcaccatgcaacaaaagct
atgacccactttacagatgagtgtgttaaaaagtatgaggcgtttttggataagtcagaa
gaatggatgagaaagatgcttcatcttaggaaacagttactatctctaactaatcagtgt
tttgatattgaagaagaagtatcaaagtatcaagactatactaatgagttacaagaaact
ttgcctcagaaaatgtttcaagcctccagtggaatcaaacataccatgaccccaatttat
ccatgttctaacacattagtagaaatgactcttggtatgaagaaattaaaagaagaaatg
gaaggagtggttaaagaacttgctgaaaataaccacattttagaaaggtttggctcttta
accatggatggtggccttcgcaatgttgactgtctttag

DBGET integrated database retrieval system