KEGG   Hipposideros armiger (great roundleaf bat): 109381699
Entry
109381699         CDS       T04661                                 

Gene name
MDM2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04068  FoxO signaling pathway
hai04110  Cell cycle
hai04115  p53 signaling pathway
hai04120  Ubiquitin mediated proteolysis
hai04144  Endocytosis
hai04151  PI3K-Akt signaling pathway
hai04218  Cellular senescence
hai04625  C-type lectin receptor signaling pathway
hai04919  Thyroid hormone signaling pathway
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109381699 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109381699 (MDM2)
   04151 PI3K-Akt signaling pathway
    109381699 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109381699 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    109381699 (MDM2)
   04115 p53 signaling pathway
    109381699 (MDM2)
   04218 Cellular senescence
    109381699 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109381699 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109381699 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381699 (MDM2)
   05202 Transcriptional misregulation in cancer
    109381699 (MDM2)
   05206 MicroRNAs in cancer
    109381699 (MDM2)
   05205 Proteoglycans in cancer
    109381699 (MDM2)
   05203 Viral carcinogenesis
    109381699 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    109381699 (MDM2)
   05220 Chronic myeloid leukemia
    109381699 (MDM2)
   05218 Melanoma
    109381699 (MDM2)
   05219 Bladder cancer
    109381699 (MDM2)
   05215 Prostate cancer
    109381699 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109381699 (MDM2)
   05169 Epstein-Barr virus infection
    109381699 (MDM2)
   05165 Human papillomavirus infection
    109381699 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109381699 (MDM2)
   01522 Endocrine resistance
    109381699 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109381699 (MDM2)
   04121 Ubiquitin system [BR:hai04121]
    109381699 (MDM2)
Enzymes [BR:hai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109381699 (MDM2)
Membrane trafficking [BR:hai04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    109381699 (MDM2)
Ubiquitin system [BR:hai04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    109381699 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB zf-RING_2 DUF1229 zf-FPG_IleRS Menin
Other DBs
NCBI-GeneID: 109381699
NCBI-ProteinID: XP_019496107
LinkDB
Position
Un
AA seq 491 aa
MCNTNMSLSPDDAASTSQIPASEQETLVRPNALLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMNKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVIVNQQEPSDSGT
SVSESRYDLEGGSDQKDPVQELQEEKPSSSHLVSRPSTSSRRRTITETEENSDELPGERQ
RKRHRSDSISFSFDESVAVCVIREIRCERSSSSESTGTPSNPDLDAGVSEQSGDWLDQDS
VSDRFSVEFEVESFNSEDYNLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEDDPEISLA
DYWKCTSCSEMNPPLPPHCNRCWALRENWLPEDKGKDKGKMPEKTELENSTQVEEGFDVP
DCKKNTVNDSQESCVEENDEKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEETVESSFPLNATEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFS
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctttgtctcctgatgatgctgcaagcacctcacagattcca
gcttcggaacaagagaccctggttagaccaaatgcattgcttttgaagttgttaaaatct
gttggtgcacaaaaagacacgtatactatgaaagaggttatattttatcttggccagtat
attatgaataaacgattatatgatgaaaagcaacagcatattgtgtattgttcaaatgat
cttctaggggatttgtttggagtgccaagcttctctgtaaaagaacacaggaaaatatat
acaatgatctacaggaacttagtaatagtcaatcagcaggaaccatcagattcaggcaca
tctgtgagtgaaagcaggtatgaccttgaaggtgggagtgatcaaaaggaccctgtgcaa
gagctacaggaagagaaaccttcatcttcacatttggtttctagaccgtctacctcatct
agaaggagaacaattactgagacagaagaaaattcagatgaattacctggtgaacgacaa
agaaagcgtcacagatctgatagtatttccttttcctttgatgaaagtgttgctgtgtgt
gtaataagggagatacgttgtgaaagaagcagtagcagtgaatcaacagggactccatca
aatccggaccttgatgctggtgtaagtgaacaatcaggtgattggttggatcaggattca
gtttcagatcgattcagtgtagaatttgaagttgaatctttcaattcagaagattataac
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtgtatcaagttactgtg
tatcaggctggggagagtgatacagattcatttgaagatgatcctgaaatttccttagct
gactattggaagtgcacttcatgcagtgaaatgaaccctccccttccaccacattgcaac
agatgttgggcccttcgtgagaattggcttcctgaagacaaagggaaagacaaagggaaa
atgcctgagaaaaccgaactagaaaactcaacacaagtagaagaaggctttgatgtccct
gattgtaaaaaaaatacagtgaatgattcccaagaatcatgtgttgaggaaaatgatgaa
aagatcacacaagcctcccaatcccaagaaagtgaggactactctcagccatcaacttct
agtagcatcatttatagcagccaagaagatgtcaaagagtttgagagggaagaaacacaa
gacaaagaagaaactgtggaatctagttttcctcttaatgccactgaaccttgtgtgatt
tgccaaggtcgacctaaaaatggctgcattgtccatggcaaaacaggacatcttatggca
tgctttacatgtgcaaagaagctaaagaaaaggaacaagccctgcccagtatgtagacag
ccaattcaaatgatagtgctaacttatttctcctag

DBGET integrated database retrieval system