KEGG   Hipposideros armiger (great roundleaf bat): 109381794Help
Entry
109381794         CDS       T04661                                 

Gene name
FIP1L1
Definition
(RefSeq) factor interacting with PAPOLA and CPSF1
  KO
K14405  pre-mRNA 3'-end-processing factor FIP1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    109381794 (FIP1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hai03019]
    109381794 (FIP1L1)
Messenger RNA biogenesis [BR:hai03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     109381794 (FIP1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fip1
Motif
Other DBs
NCBI-GeneID: 109381794
NCBI-ProteinID: XP_019496353
LinkDB All DBs
Position
Un
AA seq 603 aa AA seqDB search
MSAGEVDRLVSELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENASANP
PSGIEEETAENGVPKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNL
NIKTGGRVYGTTGTKVKGVDLDAPGNINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGF
NEDTWKAYCEKQKRIRMGLEVIPVTSTTNKITAEDCTMEVTPGAEIQDGRFNLFKVQQGR
TGNSEKETALPSTKAEFTSPPSLFKTGLPPSRNSTSSQSQTSTASRKANSSVGKWQDRYG
RAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFNKPPPFF
PPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGIPITVPPPGFPPPPGAPPPSLIPTIESG
HSAGYDSRSARAFPYGNVAFPHLPGSAPTWPSLVDTSKQWDYYARREKDRDRDRDRERER
DRDRDRERERTRERERERDHSPTPSVFNSDEERYRYRDYAERGYERHRASREKEERHRER
RHREKEETRHKSSRSNSRRRHESEEGDSHRRHKHKKSKRSKEGKEAGSEPPPEQESTEAT
PAE
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccggcgaggtcgaccgcctagtgtcggagctgagcggcgggaccggaggggat
gaggaggaagagtggctctatggcggcccatgggacgtgcatgtgcacagtgatttggca
aaggacctagatgaaaatgaagttgaaaggcccgaagaagaaaatgccagtgctaatcct
ccatctggaattgaagaagaaactgctgaaaatggcgtacctaaaccgaaagtgaccgag
actgaagatgatagtgatagtgacagtgatgatgatgaggatgatgttcatgtcactata
ggagacattaaaacaggagcaccacagtatgggagttatggtacagcccctgtaaatctt
aacattaagacaggaggaagagtttatggaactacaggaaccaaagtcaaaggggtagac
cttgatgcacctggaaacattaatggagttccactcttggaggtagatttggattctttt
gaagataaaccgtggcgtaaacctggtgctgatctttctgattattttaattatgggttt
aatgaagatacctggaaagcttactgtgaaaaacaaaagaggatacgaatgggacttgaa
gttataccagttacctctactacaaataaaattacggccgaagactgtactatggaagtt
acaccaggtgcagagatccaagatggcagattcaatctttttaaggtacagcagggaaga
actggaaattcggagaaggaaacagcgcttccatctacaaaagctgagtttacttctcct
ccttctttgttcaagactggacttccaccaagcagaaacagcacctcttctcagtctcag
acaagtactgcctccagaaaagccaattcaagcgttgggaagtggcaggatcgatatggg
agggccgaatcacctgatctaaggcgattacctggggcaattgatgttattggtcagact
ataactattagccgagtagaaggaaggcgacgggcaaatgaaaatagcaacatacaggtc
ctttctgaaagatctgctactgaagtggacaacaattttaacaaaccacctccattcttc
cccccgggagctcctcccacccacctgccacctcctccatttcttccacctcctcccact
gtcagcactgccccacctctgattcctccgccaggtattccaataactgtaccacctcca
ggttttcctcctccaccaggcgctcctcctccatctcttataccaacaatagaaagtgga
cattctgctggttatgatagtcgttctgcacgtgcttttccatatggcaatgttgccttt
ccccaccttcctggttctgctcctacatggcctagtcttgtggacaccagcaaacaatgg
gactactatgcaagacgagaaaaagaccgagatagagatagagacagagagcgagagcga
gatcgtgatcgggacagagaaagagaacgcaccagagagagagagagggagcgtgatcac
agtcctacaccaagtgttttcaacagtgatgaagaacgatacagatacagggattatgca
gaaagaggttatgaacgtcacagagcaagtcgagagaaagaagaacgacatagagaaaga
cgacacagagagaaagaagaaactagacacaagtcatctcgaagtaatagtaggcgtcgc
catgaaagtgaagaaggagacagtcacaggagacacaagcacaaaaaatctaaaagaagc
aaagaaggaaaagaagctggcagtgagcctccccctgaacaggagagcaccgaagctaca
cctgcagaataa

DBGET integrated database retrieval system