KEGG   Hipposideros armiger (great roundleaf bat): 109381815
Entry
109381815         CDS       T04661                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04020  Calcium signaling pathway
hai04072  Phospholipase D signaling pathway
hai04144  Endocytosis
hai04151  PI3K-Akt signaling pathway
hai04510  Focal adhesion
hai04540  Gap junction
hai04630  JAK-STAT signaling pathway
hai04810  Regulation of actin cytoskeleton
hai05163  Human cytomegalovirus infection
hai05200  Pathways in cancer
hai05206  MicroRNAs in cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109381815 (PDGFRA)
   04014 Ras signaling pathway
    109381815 (PDGFRA)
   04015 Rap1 signaling pathway
    109381815 (PDGFRA)
   04630 JAK-STAT signaling pathway
    109381815 (PDGFRA)
   04020 Calcium signaling pathway
    109381815 (PDGFRA)
   04072 Phospholipase D signaling pathway
    109381815 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    109381815 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109381815 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109381815 (PDGFRA)
   04540 Gap junction
    109381815 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109381815 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109381815 (PDGFRA)
   05206 MicroRNAs in cancer
    109381815 (PDGFRA)
   05230 Central carbon metabolism in cancer
    109381815 (PDGFRA)
   05231 Choline metabolism in cancer
    109381815 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    109381815 (PDGFRA)
   05218 Melanoma
    109381815 (PDGFRA)
   05215 Prostate cancer
    109381815 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109381815 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109381815 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109381815 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hai04090]
    109381815 (PDGFRA)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109381815 (PDGFRA)
Protein kinases [BR:hai01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109381815 (PDGFRA)
CD molecules [BR:hai04090]
 Proteins
  109381815 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 109381815
NCBI-ProteinID: XP_019496434
LinkDB
Position
Un
AA seq 1102 aa
MTRNGETWFQFSRAMGASHLALLVLGCLLAGPSLILCQLSLPSILPNENEKVVQLNSSFS
LRCFGESEVSWQYPMPDENRNVQIRNEENNSGFFVTVLEVVNASATHTGLYTCYYNHTQT
EENEIEGRRIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPDTPVTLLSSDGV
VLASYDSRQGFNGTFTVGPYICEATVRGKKFQTIPFNVYALKSTPELDLEMEAPKTVYKS
GETVVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLMVPEATVKDSGD
YECAARQATKEVKEMKKVTISVHEKGFIEIKPNFSQLEAVNLHEVKHFVVDVQAYPPPRI
SWLKDNLTLIENLTEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVESYTF
ELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILAN
NISNIITEVHPRDRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTV
AAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWE
FPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKI
MTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDI
FGLNPADESTRSYVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPAS
YKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLA
QGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWE
IFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLS
EIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDADNTYIGVTYKNEEDKLKDWEGGL
DEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETI
EDIDMMDDIGIDSSDLVEDSFL
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgactcggaacggagaaacttggttccagttttccagagctatgggggcttcccatctg
gcactcctggtgttaggctgcctccttgcagggccgagcctaatcctctgccagctttca
ttaccctctatcctcccaaacgaaaatgaaaaggttgtgcagctgaattcatccttttct
ctgcgatgctttggggagagtgaagtgagctggcagtaccccatgcccgacgagaatcgc
aatgtgcaaatcagaaacgaggagaacaacagtggcttttttgtgacggtgctggaagtg
gtcaatgcctcggcaacccacacgggactgtacacttgctattacaaccacacgcagaca
gaagaaaatgagattgaaggcaggcgtatttacatctacgtgccagacccagatgtagcc
ttcgtacctctaggaatgacagattacttggtcatcgtggaagacgatgattctgccatc
ataccttgtcgaacgactgatcctgatactccggtgaccttactcagcagtgacggggtg
gtgcttgcctcttacgacagcagacagggctttaacggaaccttcactgttgggccctat
atctgtgaggccaccgtcagagggaagaagttccagaccattccatttaatgtttatgct
ttaaaatccacaccagaacttgatctagaaatggaagctcctaaaactgtgtataaatca
ggggaaacagttgtggtcacctgtgccgtctttaacaacgaggtggttgaccttcagtgg
acttaccctggagaagtgaaaggcaaaggcatcacaatgctggaagaaatcaaggtccca
tctatcaaattggtgtacactctgatggtccctgaggccacggtgaaggatagtggagat
tacgaatgtgctgctcgccaggccactaaggaggttaaagaaatgaagaaagtcaccatt
tctgtccatgagaaagggttcattgaaatcaaacccaacttcagccagttggaagctgtc
aacctgcatgaagtgaaacattttgtggtggatgtgcaggcctacccccctcccaggata
tcctggctgaaagacaacctgactctgatagaaaacctcactgagatcaccaccgacata
gaaaagattcaggaaataaggtatcgaagcaaactaaagctgatccgggctaaggaagaa
gacagtggccattatactatcgtggttcaaaatgaagatgatgtggagagctatactttt
gaactcttaactcaagttccctcatctattctggacttggtcgacgaccaccatggctct
acggggggacagactgtgagatgcacagctgaagggacacctcttcctgatattgagtgg
atgatttgcaaggatattaagaaatgtaataatgagacttcatggacgattctggccaac
aacatctcaaacatcatcacggaggtccacccccgagacaggagtacagtggagggccgg
gtgacattcgccaaagtggaggagaccattgcggttcgatgtctggctaagaatctcctt
ggggctgagaaccgagagctaaagctggtggctcccactctgcgttctgaactcacggtg
gcggcagcagtcctggtgctattggtgattgtgatcatctcactgattgtcctggttgtc
atttggaaacagaaaccgaggtatgaaattcgctggagggtcattgaatcaatcagcccc
gatggacatgaatatatttatgtggacccgatgcagctgccttatgactcgagatgggag
tttccaagagatggactagtgctgggtcgtatcctgggatctggtgcgtttgggaaagtg
gttgaaggaactgcctatggattaagccggtcccaacctgtcatgaaagtagcagtgaag
atgcttaaacccacagccagatccagtgaaaaacaagctctcatgtctgaactgaagata
atgactcacctgggaccacatttaaacattgtaaacttactgggagcctgtaccaagtca
ggtcccatttacatcatcaccgagtactgcttctatggggatttggtcaactatttgcat
aagaatagggacagcttcctaagccaccacccagagaagccaaagaaagagctggacatc
tttggattgaaccctgctgatgaaagcacacggagttatgttattttatcttttgaaaac
aatggtgactacatggacatgaagcaagctgataccacgcagtatgtccccatgctggaa
aggaaagaagtttctaaatattcagacatccagagatcgctgtatgatcgcccagcctcc
tataagaagaaatctatgttagattcggaagtcaaaaacctcctttcggatgataactcg
gaaggcctcactttgttggatttgttgagctttacctatcaagttgcacgaggaatggag
tttttggcttcaaaaaattgtgtccaccgggacctggctgctcgcaatgtcctcctggca
caagggaaaattgtgaagatctgtgactttggcctggccagagacatcatgcatgattcg
aactacgtgtcaaaaggcagcaccttcctccccgtgaagtggatggctcccgagagcatc
ttcgacaacctctacaccacactgagcgacgtctggtcttacggcattctgctctgggag
atcttttcccttggtggcacaccctatcctggcatgatggtggattctactttctacaat
aagatcaagagtgggtaccggatggccaagcctgaccatgccaccagtgaagtctatgag
atcatggtgaagtgctggaacagtgagccggagaagagaccctccttttaccacctgagt
gagattgtggagaacctgctgcctggacaatataaaaagagttatgaaaagattcacctg
gacttcctgaagagcgaccatcccgccgtggcacgcatgcgcgtggacgctgacaacacc
tacatcggcgtcacctacaaaaatgaggaagacaagctgaaggactgggagggtggcctc
gatgagcagaggctgagcgcagacagtggctacatcatccctctaccggacattgaccct
gttcctgaggaggaagacctgggcaagaggaacagacacagctcacagacctctgaagag
agtgccattgagacaggttccagcagttctaccttcatcaagagagaggatgagaccatt
gaggacatcgacatgatggatgacattggcatagactcctcagatctggtggaggacagc
ttcctgtaa

DBGET integrated database retrieval system