KEGG   Hipposideros armiger (great roundleaf bat): 109382061
Entry
109382061         CDS       T04661                                 

Gene name
EIF2S1
Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha
  KO
K03237  translation initiation factor 2 subunit 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03013  RNA transport
hai04140  Autophagy - animal
hai04141  Protein processing in endoplasmic reticulum
hai04210  Apoptosis
hai04932  Non-alcoholic fatty liver disease
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05014  Amyotrophic lateral sclerosis
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05160  Hepatitis C
hai05162  Measles
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109382061 (EIF2S1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109382061 (EIF2S1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109382061 (EIF2S1)
  09143 Cell growth and death
   04210 Apoptosis
    109382061 (EIF2S1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109382061 (EIF2S1)
   05012 Parkinson disease
    109382061 (EIF2S1)
   05014 Amyotrophic lateral sclerosis
    109382061 (EIF2S1)
   05020 Prion disease
    109382061 (EIF2S1)
   05022 Pathways of neurodegeneration - multiple diseases
    109382061 (EIF2S1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109382061 (EIF2S1)
  09172 Infectious disease: viral
   05162 Measles
    109382061 (EIF2S1)
   05164 Influenza A
    109382061 (EIF2S1)
   05160 Hepatitis C
    109382061 (EIF2S1)
   05168 Herpes simplex virus 1 infection
    109382061 (EIF2S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hai03012]
    109382061 (EIF2S1)
Translation factors [BR:hai03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    109382061 (EIF2S1)
SSDB
Motif
Pfam: EIF_2_alpha S1 SoDot-IcmSS DUF4453
Other DBs
NCBI-GeneID: 109382061
NCBI-ProteinID: XP_019496858
LinkDB
Position
Un
AA seq 315 aa
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEV
DGDDDAEEMEAKAED
NT seq 948 nt   +upstreamnt  +downstreamnt
atgccgggtctaagttgtagattttatcaacacaaatttcctgaggtggaagatgtagtg
atggtgaatgtaagatccattgctgaaatgggggcttatgtcagccttctggaatacaac
aatatcgaaggcatgattcttcttagtgagttgtccagaaggcgtattcgttctataaac
aaactcatccgaattggcaggaatgaatgtgtggttgtcattagagtggacaaagaaaag
ggatatattgatttgtcaaaaagaagagtttctccagaggaagcaatcaaatgtgaagat
aaattcaccaaatccaaaactgtttacagcattcttcgtcatgttgccgaggtgttagag
tacaccaaggatgagcagctggaaagcctgttccagagaactgcttgggtctttgatgac
aagtacaagagacccggatatggtgcctatgatgcatttaagcatgcagtctcagaccca
tctattttggatagtttagatttgaatgaagatgaacgggaagtactcattaacaatatt
aataggcgtttgacaccacaggctgtcaaaatacgagcagatattgaagtggcttgttat
ggttatgaaggcattgatgccgtaaaagaagccttgagagcagggttgaattgttctaca
gaaaccatgcccatcaagattaatctaatagctccccctcggtatgtgatgactacaaca
accctggagagaacagaaggtctctctgtcctcaatcaagctatggctgttataaaagaa
aagattgaggaaaagaggggtgtcttcaatgttcaaatggagcccaaagtggtcacagat
acagatgagaccgaacttgcaaggcagctggagaggcttgagagagaaaatgcagaagtg
gatggagatgatgatgcagaagaaatggaagccaaagccgaagattaa

DBGET integrated database retrieval system