KEGG   Hipposideros armiger (great roundleaf bat): 109382229
Entry
109382229         CDS       T04661                                 

Definition
(RefSeq) 2'-5'-oligoadenylate synthase 3-like
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04621  NOD-like receptor signaling pathway
hai05160  Hepatitis C
hai05162  Measles
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109382229
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109382229
   05164 Influenza A
    109382229
   05160 Hepatitis C
    109382229
   05168 Herpes simplex virus 1 infection
    109382229
   05169 Epstein-Barr virus infection
    109382229
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     109382229
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS Polbeta DUF2228 DUF943
Other DBs
NCBI-GeneID: 109382229
NCBI-ProteinID: XP_019497121
LinkDB
Position
Un
AA seq 1935 aa
MAMAMDIYRTAAAELDSLVINSLQPPAEFVGSTRRALGSLGAALRERGGRPSAAAPTWRV
LKIAKGGSSGRGTALRGGCDAELVIFLNCFKSYKDQESRHTEILKEMQALLESWWRNPVP
GLSLEFPQRDTPGVLRFRLASADLENWMDVSLVPAFDALGQLSSNVKPKPQVYSALLDSG
CQAGEHAACFSELRRNFVNMRPTKLKNLILLVKHWFRQVCSQKTWREMPPAYALELLTIY
AWEQGCGKDAFSLAQGLRTVLGLIQQYKSLCVFWTINYHFKDPAVNRFLQHQLERPRPVI
LDPADPTWDVGNGAAWHWDLLAQEAKSGYDRPCFLQAAGGAMPPWEVPGLPRARCSGLDH
HIPQDPVQKTPKDSGSLDAVHPRTGSRQPPFPAPARSTPGMVLDLSQIPAKELDRFIQDH
LKPSPQFQKQMNKAIDVILCCLREKCAHKASRVSKGGSFGRGTNLRGGCDAELVIFLNCF
ENYKDQGALRAKILDDMRAQLESWWRDPVPGLSLKFPSQTVPKALQFQLMSTVLKSWMDV
SLLPVFDAVGQLSSGAKPEPQVYSTLLNSGCQEGEHVACFSELRRSFVNMRPAKLKNLIL
LVKHWYHQVAAQNKGERPAYASLPAAYALELLTIYAWEQGCGEDRFNMAQGLRTVLGLVQ
KHQQLCVFWTVNYSFEDPALTTHLLGXLRKPRPLVLDPADPTWNVGQGSWELLAQEAAAL
EMQACLMGTEGTPVQPWDVMPALLYQTPAVDLDRFICDFLQPDRQFLAQVNKAVDTICSF
LRENCFRNSSTKVLKVVKGGSSAKGTALGGRSDADIVVFLSCFSQFTEQGNRRAEIISEI
RDQLEACQREKHFEVKFKISKWDNPRVLRFSLTSQTMLDQSVDFDVLPAFDALGQLRPHS
RPHPQVYVDLIRNCHHAGEYSSCFTELQRDFIICRPTKLKSLIRLVKHWYQQCKKKTKEK
GSLPPQHGLELLTVYAWEQGGKDPRFNMAEGFRTVLELVTQYHQLRVYWTINYNYEDKTI
RDFLKQQLQKTRPIILDPADPTGNLGPNARWDLLAKEAAACISALCCMGRDGTPIQPWPV
KCVHLDTMPYLPSWIYTEFLSFLLTCWNATSGVLHPKYQKVSQCLNNGAQPVPVCPPEKI
HQVHAGGTPDLYHHHCLTPSKLGSRPGTAATNISQKLAATSTTGRLATQELLFLLCLPLC
HSLSPQQPAGAMGNVVQPLPAQELDAFIQKYLRPFEGCQKQIDEAVNTICDALQETEEFP
LVTGVAKGGSYGRETVLRGNSDGILVIFVRDLEEFKDQMEIPHEILDKIWKRLKDCQLER
KLEAKMEIQTPHGGLTVLLSTRSQSITFEVLPAFNALALSEQPSPQTYRELKRSLDMTEA
SPGEFSVCFTKLQQNFFKNHPRKLKDLILLVKHWYQQCQQKLMAPLLPPSYALELLTVYA
WEQGCGAEDFEIAEGLRTVLGLIKKQAHLRVYWTVNYNFEDETVRNIVLSQIRSPSRFPR
PVILDPTDPTNNVSKDITCWELLKEEAESWLFCLNEPPGPSWNVLPAPLQETPGHLLDKF
IKDFLQPNERFLKQLRRAVDIICKFLKENCFRDSPTKVQKAVKGGSAGKGTTLKTGSDAD
LVVFVSSLKSYTDQNTERHYIIKEIQKQLETCQQEKEFEVKFEISKWKAPRVLSFSLKSK
EFIESVDFDVLPAFNALGELKYGSVPNPRAYTELIRLYKSSNFSEGEFSTCFTELQRDFI
STRPTKLKDLIRLVKHWYKQCERKLKKKGSLPPKYALELLTIYAWEQGSGLQDFDTAEGF
RTVLELVKQHRQLCIFWTVNYNFENEIVRNFLLTQIQKARPVILDPADPTGDVGGGDRWC
WHLLAKEATEWLFSLCFKDGVGRPVRLWHVPTVQTPGSCGAVLHPVVNKMFTYSIHEILN
ENAGRNFQRSPGSCF
NT seq 5808 nt   +upstreamnt  +downstreamnt
atggccatggccatggacatctaccgcaccgccgccgccgagttggacagcctggtgatc
aacagcctgcagccgcccgcggagttcgtgggaagcacgcggcgtgccctcggctccctg
ggagctgccctgagagagcgcgggggtcgcccctcggccgctgcccctacatggcgggtg
ctgaaaatcgccaagggaggttcctctggccggggcacggctctgcggggtggctgtgat
gccgaactcgtcatcttcctcaactgcttcaagagctataaggaccaagagtctcgtcat
acagagatcctcaaggagatgcaagcactgctggaatcctggtggcggaacccagtcccc
ggtctgagccttgagtttcctcagcgggacacacctggggtccttcggttccgactggcc
tccgcagaccttgaaaactggatggatgtcagcttggtgcccgcctttgatgctctgggg
cagctcagctccaacgtgaaacccaagccccaggtctactcggccctcttagacagtggc
tgccaggcaggcgagcacgcggcctgcttctcagagctacggaggaatttcgtgaacatg
cgcccaaccaagctgaagaacctgattctgctggtgaagcactggttccgccaggtgtgc
tcacagaagacgtggagggagatgcccccagcctacgccctggagctgctgaccatctac
gcctgggagcagggttgtgggaaggatgcctttagcttagcccaaggcctccgaaccgtc
ctgggcctgatccaacagtataagagcctgtgtgttttctggaccatcaactaccacttc
aaggaccctgcagttaacaggttcttgcagcaccagcttgagagacccaggcctgtgatc
ctggacccagctgaccccacgtgggacgtggggaacggggctgcctggcactgggatctg
ctggctcaagaggctaagtccggctatgaccgcccgtgctttcttcaggcagcagggggc
gctatgccgccctgggaggtgccaggcctcccacgcgcccggtgctcaggtttggatcac
cacatcccgcaagaccctgtccagaagacccccaaggacagcggcagtctggatgctgtg
cacccaaggacagggagcaggcagcccccgttcccagctcctgcccgctccacacctggg
atggtcttggatctgtctcagatccccgccaaggagctggaccgcttcatccaggaccac
ctgaaaccaagcccgcagttccagaagcagatgaacaaggccatcgatgtgatcctgtgc
tgcctccgcgagaaatgtgcccacaaggcctcgagagtcagcaagggaggctcattcggc
cggggcaccaacctcaggggtggctgtgatgctgaactcgtcatcttcctcaactgcttt
gaaaactacaaagaccagggggccctccgtgcaaagatccttgatgatatgcgggcacag
ctggaatcctggtggcgggatccagtccctggcctgagcctcaagtttccaagccagacg
gtgcccaaggctttgcaattccagctaatgtccacggtcttaaaaagctggatggacgtc
agcctgctgcccgtctttgatgccgtgggacagctcagctctggcgccaagcctgagccc
caggtctactcaacgctcctcaacagtggctgccaagagggcgagcacgtggcctgcttc
tcagagctgcggagaagctttgtgaacatgcgcccagccaagctgaagaacctgattctg
ctagtgaagcactggtaccatcaggttgcagctcaaaacaaaggagaacggccagcctat
gcctccctgcccgcagcctacgccctggagcttctgaccatctatgcctgggagcagggc
tgtggagaggaccgtttcaacatggcccaaggcctaaggaccgtcctggggcttgtccag
aagcaccagcagctctgtgtcttctggacagtcaactatagctttgaggacccagctctc
acaacgcaccttcttggctagcttcggaaacccaggcccctggtcctggaccctgccgac
cccacctggaacgtgggccagggtagctgggagctgttggcccaggaagcggcagctctg
gagatgcaggcctgcttgatgggtacagaagggacgcctgtgcagccctgggatgtgatg
cccgctctcctttaccaaactccagccgtggacctcgacaggttcatctgtgactttctc
cagcctgaccgccagttcctggctcaagtaaacaaggctgttgataccatctgctcattc
ctgagggaaaactgcttccggaattcttccaccaaagtgctcaaggtagtcaagggtggc
tcttcagccaaaggcacagctctgggaggacgctcagatgccgacatagtggtgttcctc
agctgcttcagccagttcaccgagcaagggaacaggcgggccgagatcatctcggagatc
cgagaccagctggaggcatgtcagcgggagaagcatttcgaagtgaagttcaagatctcc
aagtgggacaatccccgcgtgctgaggttctcgctgacatcccagacgatgctggatcag
agtgtggacttcgacgtgctgccagcctttgacgccctaggccagctgcgcccccactcc
aggccccaccctcaagtctacgtggacctcatccgcaactgccaccacgcaggcgagtat
tcctcctgcttcacagagctgcagcgggacttcatcatctgtcgccccaccaagctgaag
agtctgatccgactggtgaagcactggtaccagcagtgcaagaagaaaaccaaggagaaa
ggctccctgcccccgcaacacgggctggaactcctgacggtgtatgcctgggagcagggt
gggaaggacccccggttcaacatggctgagggctttcgcactgtcctggagctggtcacc
cagtaccaccagctccgtgtctactggaccatcaactacaactatgaggacaagaccatc
agagacttcctgaaacagcagcttcagaagaccaggcccatcatcctggatccagctgac
ccgacgggcaacctgggccccaacgcccgctgggacctgctggccaaggaagctgcagcc
tgcatatctgccctgtgctgcatgggcagggatggcacccccatccagccatggccagtg
aagtgtgtacatcttgacaccatgccctacttgccttcctggatttatactgagttcctc
tctttcctcctgacctgctggaatgccaccagtggggtcctccatcccaaatatcaaaaa
gtgagccaatgcctaaacaacggtgctcagcccgttcctgtctgccctccagagaaaatc
caccaggtccatgcaggaggcactcctgacctctaccatcaccactgcctcacaccctcg
aagctggggtccagacccgggacagcagccacaaacatctctcagaagttggcagccacc
agcactacaggaagactggcaacacaggagttgctctttctcctctgtctcccgctctgc
cattcgctgtcacctcagcagccagcaggagcaatgggaaacgtggtacagccactgcct
gctcaggaattggatgcctttatccagaaatacctgaggccctttgaaggctgtcagaaa
cagatcgatgaggctgtgaacaccatctgcgatgccctgcaggagaccgaggagttcccc
ctggtgacaggtgtggccaaaggtggctcttatggccgggaaacggtcttaagaggcaac
tccgatggtatcctcgtcatctttgtccgtgaccttgaagaattcaaggatcagatggaa
atcccacatgaaatcctcgacaaaatctggaagcgcctgaaagactgtcagcttgaaagg
aagctggaagccaagatggagatccagacgccccatggcgggctcaccgtcctgctgtcc
acaagatcgcaaagcatcacttttgaggtgctgcctgccttcaatgctctggccttaagt
gagcagcccagcccccagacctatcgagagctgaaaagatctctggatatgacagaagcc
agccctggcgaattctcagtctgcttcacaaaactccagcagaatttttttaagaaccat
cccagaaaactgaaggatttgatcctcttggtaaaacactggtatcaacagtgtcagcaa
aagctgatggctccacttctaccaccctcgtatgctctggagctgctcacagtctacgcc
tgggagcaggggtgcggagcagaagactttgagatagccgaaggcctcagaacggttctg
gggctcatcaaaaagcaggcgcatctgcgtgtctactggacagtcaactacaactttgag
gatgagaccgtccggaacattgtgctgagccagatccgatcccccagtagatttcctagg
ccagtaatcttggatccaactgacccaaccaataatgtgagcaaagatatcacatgctgg
gaactgctgaaagaagaagctgaaagctggttgttctgcctgaatgagccacccggacca
tcttggaatgttctgccagcaccgctccaggagaccccgggtcatcttctggataagttc
atcaaggactttctccagcccaacgaacgcttcctaaagcagctccgcagagctgttgac
atcatctgtaaattccttaaagaaaactgctttagagattcacctacaaaggttcagaag
gctgtcaagggagggtcggccggcaaaggcacaactctgaagactggttctgacgccgac
cttgtcgtgttcgtcagctcacttaaaagctacaccgaccaaaacacagagagacactac
atcatcaaggaaatccaaaaacagctagaaacctgtcagcaggagaaggagtttgaagtg
aagtttgagatttcaaaatggaaggctcccagggtgctgagcttctctctaaaatccaaa
gaattcatcgaaagtgtcgactttgatgtgctgcctgcatttaacgcactaggagaactg
aaatatggctctgtacccaaccccagggcctacactgagctcatccgtctgtataagtcc
tcaaacttctcggagggagaattttctacctgttttacggagctgcagcgtgactttatt
agcactcgacccaccaaactgaaggatttaattcgcctggtgaagcactggtacaaacag
tgtgaaaggaaactgaagaaaaaggggtctctgccccccaagtacgccctggagctgctc
accatctacgcctgggagcaggggagtgggctgcaggattttgacaccgcggaaggtttc
cggactgtcctggagttggtcaaacaacatcggcagctctgtatcttctggacggtcaat
tacaactttgagaatgagattgtgaggaacttcctactgacccagatccagaaagccagg
cctgtgatcttggacccagccgaccctactggcgacgtgggtggaggggaccgttggtgt
tggcatcttcttgcgaaagaagccaccgaatggctgttctctctgtgcttcaaagatggg
gttggacgtcctgtacgactgtggcatgtgccgacggtgcagacaccaggaagctgtgga
gctgtgttgcatcctgttgtcaataagatgttcacatacagtattcatgaaatcctcaat
gaaaatgctgggagaaacttccagaggtcacccggcagttgcttctga

KEGG   Hipposideros armiger (great roundleaf bat): 109382257
Entry
109382257         CDS       T04661                                 

Definition
(RefSeq) 2'-5'-oligoadenylate synthase 1-like
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04621  NOD-like receptor signaling pathway
hai05160  Hepatitis C
hai05162  Measles
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109382257
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109382257
   05164 Influenza A
    109382257
   05160 Hepatitis C
    109382257
   05168 Herpes simplex virus 1 infection
    109382257
   05169 Epstein-Barr virus infection
    109382257
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     109382257
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS
Other DBs
NCBI-GeneID: 109382257
NCBI-ProteinID: XP_019497168
LinkDB
Position
Un
AA seq 350 aa
MELCAIPAKNLDKFIEEHLLPNTLFRSQVKQAVDIICSFLKEKCFQSASHLVRVSKVVKG
GSSGKGTALRGRSDADLVVFLSHLRSFKEQFDRRGEFIQEIRKQLEACERQNMFAIEFEV
QGGHVWSNPRVLSFVLSSPRLSESVEFDVLPAFDVLGQVTGDYRPNPEIYVRLIQECEEL
GLKEGGEFSTCFTELQRGFLRERPTKLKSLIRLVKHWYKECKKKHGSPLPPQYALELLTV
YAWERGCNKTEFNTAEGFRTVLELVRNYQQLWIYWTKYYNFENPVICDYLMKQLHKPRPV
ILDPADPTGNVAGGDRHRWQRLAKEAEVCLSYPCFKTWNGSPVDSWNVQC
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggagctctgtgctatcccggctaagaatctggacaagttcattgaagaacacctgcta
ccaaacacgcttttccgctcgcaggtcaaacaagccgtcgacattatctgcagtttcctg
aaggaaaagtgttttcaaagtgcctcccaccttgtccgggtgtccaaagtcgtgaagggc
ggctcctcaggcaaaggcacggccctcagaggccgatctgatgctgacctggtcgtcttc
ctcagccacctcagaagttttaaggagcagtttgatcgcagaggagagttcatccaggaa
ataaggaagcagctggaggcctgtgaaagacagaatatgtttgccatagagtttgaggtc
cagggtggtcatgtatggagtaaccctcgtgtactcagcttcgtgctcagctcccccagg
ctctccgaaagcgtggaatttgatgtactgcccgcctttgatgtcctggggcaggtgacg
ggcgactacagacctaaccctgagatctatgtccggctcatccaagagtgcgaagagcta
ggtctgaaagagggtggtgagttctctacctgcttcacggagctgcagcgaggcttccta
agggagcgtccaaccaagctcaagagcctcatccgcctagtcaagcactggtacaaagag
tgtaagaagaagcatggatcgcccctgccaccacagtatgccctggagctcctgacagtc
tatgcttgggaacgtgggtgcaacaaaacagaattcaacacagctgagggatttcggact
gtcttggaattagtccggaactaccaacagctttggatctactggacaaagtattacaac
tttgaaaatcctgtcatttgtgactacctgatgaagcagctccacaaacccaggcctgtg
attctagatccagctgaccctacaggaaatgttgctggtggagaccgacatcgctggcag
cggctggcaaaggaggctgaagtctgcttgagttacccatgctttaagacttggaatggg
tctccagtggactcctggaatgtacagtgctaa

DBGET integrated database retrieval system