KEGG   Hipposideros armiger (great roundleaf bat): 109382254Help
Entry
109382254         CDS       T04661                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00010  Glycolysis / Gluconeogenesis
hai00053  Ascorbate and aldarate metabolism
hai00071  Fatty acid degradation
hai00280  Valine, leucine and isoleucine degradation
hai00310  Lysine degradation
hai00330  Arginine and proline metabolism
hai00340  Histidine metabolism
hai00380  Tryptophan metabolism
hai00410  beta-Alanine metabolism
hai00561  Glycerolipid metabolism
hai00620  Pyruvate metabolism
hai01100  Metabolic pathways
Module
hai_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109382254 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    109382254 (ALDH2)
   00620 Pyruvate metabolism
    109382254 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109382254 (ALDH2)
   00561 Glycerolipid metabolism
    109382254 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109382254 (ALDH2)
   00310 Lysine degradation
    109382254 (ALDH2)
   00330 Arginine and proline metabolism
    109382254 (ALDH2)
   00340 Histidine metabolism
    109382254 (ALDH2)
   00380 Tryptophan metabolism
    109382254 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109382254 (ALDH2)
Enzymes [BR:hai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109382254 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 109382254
NCBI-ProteinID: XP_019497163
LinkDB All DBs
Position
Un
AA seq 521 aa AA seqDB search
MLRATALAAAGLGPRLGRRLLSAAATHAVPAPNQQPEVFYNKIFINNEWHDAVSKKMFPT
INPSTGEVICQVAEGDKEDVDRAVKAARAAFQLGSPWRRMDASERGRLLNRLADLIERDR
TYLAALETLDNGKPYLSSYLVDLDMVLKCFRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVN
IVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHKIQVASGHSNLKRVTLELGGKSPNIIMS
DADMDWAVEQAHFALFFNQGQCCCAGSRVFVQEDVYAEFVERSVTRAKSRVVGNPFDNRT
EQGPQVNETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTLFGDVQDGMTIAKEE
IFGPVMPILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVF
GAQSPFGGYKMSGVGRELGEYGLQMYTEVKTVTVKVPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttacgcgccacagcactcgccgccgcgggactcgggccccgcctgggccgccgcctg
ctgtctgctgccgccacccacgctgtgccggcccccaaccagcagcccgaggtcttctac
aacaagatcttcataaacaatgaatggcacgatgctgtcagcaagaaaatgtttcccacc
atcaatccatccaccggggaagtcatctgccaggtagctgaaggagacaaggaagacgtg
gatagggcagtaaaggctgcccgggccgccttccagctgggctcaccctggcgccgcatg
gacgcgtccgaaaggggccgcctgctgaaccgcctggccgacctgattgagcgggaccgt
acctacctggccgctttggagactctggataatggcaagccctacctcagctcctacctg
gtggatttggacatggtcctcaaatgtttccgttattatgctggctgggcggataagtac
cacgggaaaaccattcccattgatggggacttctttagttacacccgccatgaacctgtg
ggggtgtgcgggcagatcatcccgtggaacttcccactcttgatgcaagcgtggaaactg
ggcccagccttggcgactggaaacgtggttgtgatgaaggtggccgagcagactccactc
actgccctctatgtggccaacctgattaaggaggctggcttcccccctggcgtggtcaat
attgttcctggatttggacccacggctggggctgccatcgcctcccacgaggatgtggac
aaagtggccttcacaggctccactgaggttggccacaaaatccaggttgcttcggggcac
agtaacctcaagagagtgaccctggagctggggggcaagagtcccaacatcatcatgtca
gatgctgacatggactgggccgtggagcaggcccactttgccctgttcttcaaccagggc
cagtgctgctgtgcgggctccagggtctttgtgcaggaggatgtgtatgcggagtttgtg
gagcggagcgtcacccgggccaagtctcgggtggttgggaacccctttgacaaccggacc
gagcaggggccacaggtgaacgaaactcagtttaagaaggtccttggctatatcaaatct
gggaaggaggagggggcgaagctgctgtgtggtggaggggcagctgctgaccgtggctac
ttcatccagcccactttgtttggagacgtgcaagacggcatgaccatcgcaaaggaggag
atctttgggccagtgatgccgatcctgaagtttaagaccatagaggaagtcgttgggaga
gccaacaattccaagtacgggctggccgcagctgtcttcacaaaggacttggacaaagcc
aactatctgtcccaagcactccaggctggtactgtgtgggtcaactgctacgatgtgttt
ggggcccagtcgccatttggtggctacaagatgtctggggttggccgggagctgggcgag
tatggtctgcagatgtacactgaagtgaaaaccgtcacagtcaaagttcctcagaagaac
tcgtaa

DBGET integrated database retrieval system