KEGG   Hipposideros armiger (great roundleaf bat): 109382577
Entry
109382577         CDS       T04661                                 

Gene name
IL3
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04630  JAK-STAT signaling pathway
hai04640  Hematopoietic cell lineage
hai04664  Fc epsilon RI signaling pathway
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05221  Acute myeloid leukemia
hai05310  Asthma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109382577 (IL3)
   04151 PI3K-Akt signaling pathway
    109382577 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109382577 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109382577 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109382577 (IL3)
   04664 Fc epsilon RI signaling pathway
    109382577 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109382577 (IL3)
   05202 Transcriptional misregulation in cancer
    109382577 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109382577 (IL3)
  09163 Immune disease
   05310 Asthma
    109382577 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109382577 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109382577 (IL3)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interleukins
   109382577 (IL3)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Haparin
  Cytokines
   109382577 (IL3)
SSDB
Motif
Pfam: IL3 Borrelia_REV DUF1939
Other DBs
NCBI-GeneID: 109382577
NCBI-ProteinID: XP_019497709
LinkDB
Position
Un
AA seq 137 aa
MSSLPVLHVLLLLLALHAPRAQGQPLRTQSTENYDNIIEEIMGILNESTVPPEQHTMDPN
EIPVLMEGNLWLNLDAFLNATNNFKEKGMKIKANLEKFKQLLPTPTSEEKTIDINGWHDF
QKKLTMYLARLKQSGWF
NT seq 414 nt   +upstreamnt  +downstreamnt
atgagcagcctccccgtcctgcacgtgctcctgctcctgctcgcactccatgcccctcgg
gcacagggacagcccctgaggacacaatcgactgagaactatgacaacatcatcgaggaa
attatgggcatcctaaacgagtctactgtgcctccagaacagcacaccatggacccaaat
gagatacccgtcctgatggaaggcaacctgtggctgaacctggatgcattcttgaatgct
accaacaatttcaaggagaaaggaatgaaaatcaaggcaaatcttgagaaattcaagcaa
ttgctgcccacccccacgtcggaggaaaaaacaatcgatatcaatggctggcacgatttc
cagaagaaattaactatgtatctggcccgccttaagcagtccggatggttttag

DBGET integrated database retrieval system