KEGG   Hipposideros armiger (great roundleaf bat): 109382592
Entry
109382592         CDS       T04661                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04060  Cytokine-cytokine receptor interaction
hai04151  PI3K-Akt signaling pathway
hai04630  JAK-STAT signaling pathway
hai04640  Hematopoietic cell lineage
hai04657  IL-17 signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04672  Intestinal immune network for IgA production
hai05140  Leishmaniasis
hai05200  Pathways in cancer
hai05310  Asthma
hai05320  Autoimmune thyroid disease
hai05321  Inflammatory bowel disease
hai05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109382592 (IL4)
   04151 PI3K-Akt signaling pathway
    109382592 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109382592 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109382592 (IL4)
   04660 T cell receptor signaling pathway
    109382592 (IL4)
   04658 Th1 and Th2 cell differentiation
    109382592 (IL4)
   04659 Th17 cell differentiation
    109382592 (IL4)
   04657 IL-17 signaling pathway
    109382592 (IL4)
   04664 Fc epsilon RI signaling pathway
    109382592 (IL4)
   04672 Intestinal immune network for IgA production
    109382592 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109382592 (IL4)
  09163 Immune disease
   05310 Asthma
    109382592 (IL4)
   05320 Autoimmune thyroid disease
    109382592 (IL4)
   05321 Inflammatory bowel disease
    109382592 (IL4)
   05330 Allograft rejection
    109382592 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109382592 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hai04052]
    109382592 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109382592 (IL4)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Interleukins
   109382592 (IL4)
Glycosaminoglycan binding proteins [BR:hai00536]
 Heparan sulfate / Haparin
  Cytokines
   109382592 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 109382592
NCBI-ProteinID: XP_019497725
LinkDB
Position
Un
AA seq 133 aa
MHLTSQLIPVLVCLLACTSNFIHGHKLILQEIIKTLNFRTVPKDWCMELTVADVLTAPKN
TTENEVFCRATMVLRQIYKHHTCLNSRSLKKLDRNLSSMANMTNCPVNKDNMTTLKNFLE
RLKSIMQEKYAKS
NT seq 402 nt   +upstreamnt  +downstreamnt
atgcatctcacctcccaactgatcccagttctggtctgcctactagcatgtaccagcaac
ttcatccatggacacaagctcatcttacaggagatcatcaaaacgctgaacttccgcaca
gtgccaaaggactggtgcatggagctgactgtagcagacgtcttgactgccccaaagaac
acaactgagaatgaagtcttctgcagggccacgatggtgcttcggcaaatctacaaacac
cacacgtgcttgaacagtaggtccctgaaaaaactggacaggaacctcagcagcatggcc
aacatgaccaattgccctgtgaacaaagacaatatgaccaccttgaaaaacttcttggaa
agactaaagagcatcatgcaagagaaatatgcaaagagttga

DBGET integrated database retrieval system