KEGG   Hipposideros armiger (great roundleaf bat): 109382625
Entry
109382625         CDS       T04661                                 

Gene name
VDAC1
Definition
(RefSeq) voltage dependent anion channel 1
  KO
K05862  voltage-dependent anion channel protein 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04020  Calcium signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04217  Necroptosis
hai04218  Cellular senescence
hai04621  NOD-like receptor signaling pathway
hai04979  Cholesterol metabolism
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05014  Amyotrophic lateral sclerosis
hai05016  Huntington disease
hai05017  Spinocerebellar ataxia
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109382625 (VDAC1)
   04022 cGMP-PKG signaling pathway
    109382625 (VDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109382625 (VDAC1)
   04218 Cellular senescence
    109382625 (VDAC1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109382625 (VDAC1)
  09154 Digestive system
   04979 Cholesterol metabolism
    109382625 (VDAC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109382625 (VDAC1)
   05012 Parkinson disease
    109382625 (VDAC1)
   05014 Amyotrophic lateral sclerosis
    109382625 (VDAC1)
   05016 Huntington disease
    109382625 (VDAC1)
   05017 Spinocerebellar ataxia
    109382625 (VDAC1)
   05020 Prion disease
    109382625 (VDAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    109382625 (VDAC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109382625 (VDAC1)
   05164 Influenza A
    109382625 (VDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hai03029]
    109382625 (VDAC1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hai04040]
    109382625 (VDAC1)
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    109382625 (VDAC1)
Ion channels [BR:hai04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   109382625 (VDAC1)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 109382625
NCBI-ProteinID: XP_019497796
LinkDB
Position
Un
AA seq 283 aa
MAVPPTYIDLGKPARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt   +upstreamnt  +downstreamnt
atggccgtgcctcccacgtacattgaccttggcaaacctgccagggacgtcttcaccaag
ggctatggatttggcttaataaaactcgatttgaaaacaaaatctgagaatggactggaa
tttacaagctcaggttcagccaacactgagaccactaaagtgaacggcagtctggaaacc
aagtacagatggactgaatatggtctgacgtttacagagaagtggaacactgacaacaca
ctaggcacggagattactgtggaagatcagcttgcacgcggactgaagctgaccttcgat
tcatccttctccccaaacactgggaaaaaaaatgctaaaatcaagacagggtacaagcgg
gagcatatcaacctgggctgcgacgtggatttcgacatcgcggggccttcgatccggggc
gccctggtgctaggttatgagggctggctggctggctaccagatgaattttgagaccgca
aagtctcgagtgacccagagcaactttgcggttggctacaagactgatgaattccagctt
cacactaatgtaaatgatgggacagagtttggtggctctatttatcagaaggtgaacaaa
aagttggagactgctgttaatctcgcctggacagcaggaaacagtaacactcgcttcgga
atagcagccaagtatcagatcgaccctgatgcctgcttctcggcgaaagtgaataactcc
agcctgataggtttaggatacacgcagaccctcaagccaggtatcaaactgacgctgtca
gctctgctggatggcaagaatgtcaatgctggtggccacaagcttggtctaggactggaa
tttcaagcataa

DBGET integrated database retrieval system