KEGG   Hipposideros armiger (great roundleaf bat): 109382891
Entry
109382891         CDS       T04661                                 

Gene name
CCND3
Definition
(RefSeq) cyclin D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04110  Cell cycle
hai04115  p53 signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04218  Cellular senescence
hai04310  Wnt signaling pathway
hai04390  Hippo signaling pathway
hai04510  Focal adhesion
hai04630  JAK-STAT signaling pathway
hai05162  Measles
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109382891 (CCND3)
   04390 Hippo signaling pathway
    109382891 (CCND3)
   04630 JAK-STAT signaling pathway
    109382891 (CCND3)
   04151 PI3K-Akt signaling pathway
    109382891 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109382891 (CCND3)
   04115 p53 signaling pathway
    109382891 (CCND3)
   04218 Cellular senescence
    109382891 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109382891 (CCND3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109382891 (CCND3)
   05203 Viral carcinogenesis
    109382891 (CCND3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109382891 (CCND3)
   05162 Measles
    109382891 (CCND3)
   05164 Influenza A
    109382891 (CCND3)
   05169 Epstein-Barr virus infection
    109382891 (CCND3)
   05165 Human papillomavirus infection
    109382891 (CCND3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 109382891
NCBI-ProteinID: XP_019498257
LinkDB
Position
Un
AA seq 292 aa
MELLCCEGSRHAPRAGPDPRLLGDHRVLQSLLRLEERYVPRASYFQCVQKEIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTHKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLALILHRLSLPSDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSISGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREASKTSPSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaactgctatgctgcgagggctcccggcacgcgcctcgggccgggcccgacccgcgg
ctgttgggggaccaccgtgtcctgcagagcctgctccgcctggaggagcgctacgtgccc
cgcgcctcctacttccagtgcgtgcagaaggagatcaagccgcacatgcggaagatgctg
gcgtactggatgctggaggtgtgtgaggagcagcgctgtgaggaggaagtcttccccctg
gccatgaactacttggatcgctacctgtcctgcgtccccacccacaaggcacagttgcaa
ctcctgggtgcggtctgcatgctgctggcctccaagctgcgggagactacgcccctcacc
atcgaaaaattgtgcatctacaccgaccacgctgtctctccacgccagctgcgggactgg
gaggtgctggtcctggggaagctcaaatgggacctagctgctgtgattgcccacgatttc
ctggccctgatcctgcaccggctctctctgcccagtgaccgacaggccttggtcaaaaag
cacgcccaaacctttctggccctctgtgctacagattacacctttgccatgtacccaccg
tccatgatcgccacgggcagcattggggctgcagtgcaaggcctgggcgcgtgctccata
tctggggacgagctcacagagctgctggcagggatcacaggcactgaagtggactgcctg
cgggcctgtcaggagcagattgaagctgcactcagggagagtctcagggaagcctccaag
acctcccccagcccagctcccaaagcccccaggggctccagcagccaggggcccagccag
accagcactcccacagatgtcacagcaatccacctgtag

DBGET integrated database retrieval system