KEGG   Hipposideros armiger (great roundleaf bat): 109383166
Entry
109383166         CDS       T04661                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01522  Endocrine resistance
hai04012  ErbB signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04110  Cell cycle
hai04151  PI3K-Akt signaling pathway
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04934  Cushing syndrome
hai05162  Measles
hai05165  Human papillomavirus infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05203  Viral carcinogenesis
hai05206  MicroRNAs in cancer
hai05215  Prostate cancer
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109383166 (CDKN1B)
   04066 HIF-1 signaling pathway
    109383166 (CDKN1B)
   04068 FoxO signaling pathway
    109383166 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    109383166 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109383166 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109383166 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    109383166 (CDKN1B)
   05206 MicroRNAs in cancer
    109383166 (CDKN1B)
   05203 Viral carcinogenesis
    109383166 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    109383166 (CDKN1B)
   05220 Chronic myeloid leukemia
    109383166 (CDKN1B)
   05215 Prostate cancer
    109383166 (CDKN1B)
   05222 Small cell lung cancer
    109383166 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109383166 (CDKN1B)
   04934 Cushing syndrome
    109383166 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    109383166 (CDKN1B)
   05169 Epstein-Barr virus infection
    109383166 (CDKN1B)
   05165 Human papillomavirus infection
    109383166 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109383166 (CDKN1B)
SSDB
Motif
Pfam: CDI Peptidase_M16_C
Other DBs
NCBI-GeneID: 109383166
NCBI-ProteinID: XP_019498868
LinkDB
Position
Un
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKYCRDMEEASQRKW
NFDFQNHRPLPGRYEWQEVEKGSVPEFYSRPPRPPKDACKVPAQESLDLSGNRQAVSLIG
SQANSEDTHLVDQKTDASDGQTGLAEPCTGIRKRPATDDASPQNKRANRTEENVSDASPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtatctaacgggagccccagcctggagcggatggacgccaggcag
gcggagtaccccaagccctccgcctgccgaaatctctttggccccgtgaatcacgaagag
ctaacccgggacttggagaaatactgccgagacatggaagaggcaagccagcgcaagtgg
aattttgattttcagaatcacaggcccctgccgggcagatacgagtggcaggaggtggaa
aagggcagtgtgcccgagttctactcccgacccccgcggccgcccaaagacgcctgcaag
gtgcccgcgcaggagagcctggatctcagcgggaaccgccaggcggtgtctttaattggc
tctcaggcaaactcagaggacacacacttggtagaccaaaagactgatgcttcggacggc
cagacgggcttagcggagccgtgcactgggataaggaagcgacctgccactgacgatgcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtttcagatgcttccccgaac
gcgggttcagtggagcagacgcccaagaagccgggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system