KEGG   Hipposideros armiger (great roundleaf bat): 109383329Help
Entry
109383329         CDS       T04661                                 

Gene name
PPCS
Definition
(RefSeq) phosphopantothenoylcysteine synthetase
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00770  Pantothenate and CoA biosynthesis
hai01100  Metabolic pathways
Module
hai_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    109383329 (PPCS)
Enzymes [BR:hai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     109383329 (PPCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP NusA_N
Motif
Other DBs
NCBI-GeneID: 109383329
NCBI-ProteinID: XP_019499209
LinkDB All DBs
Position
Un
AA seq 311 aa AA seqDB search
MAEVELVAEFPQPAGVARSAEAMVRFAAGLGAQGRRVVLVTSGGTKVPLEARPVRFLDNF
SSGRRGATSAEAFLAAGYGVLFLYRARSAFPFAHRFPPQTWLSALRPSSRSPSGLLSLEA
EENALPGFAAALRSYQEAAAAGTFLAVEFTTLTEYLHLLRAAAQALNPLGPSAMFYLAAA
VSDFYIPVSEMPEHKIQSSGGPLQITMKMVPKMLFPLVKDWAPKAFVISFKLETDPSIVI
DRARNALEVYRHQVVVANILESRRSFVVIVTKDSETKLSLSEEEVEKGTEIEEKIVVDLQ
SRHTAFIEDKN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagtggagttagtcgctgagttccctcagcccgctggtgttgcccgctcggcc
gaggctatggttcgcttcgccgccgggctgggtgcgcagggaagacgggtggtgttggtc
acatccggcggcaccaaggtcccattggaagcccggccagtgcgcttcctggacaacttc
agcagcgggcggcgcggtgcaacctcagcggaggccttcctggctgcgggctacggcgtt
ctgttcctgtaccgtgctcgctccgccttcccctttgcccaccgcttccctccccaaacc
tggctgtcggctctgcggccctccagccgatccccttccggcttactgagcctggaggct
gaggagaatgcactcccgggcttcgctgcggctctgcggagctaccaggaagctgctgct
gccggcaccttcctggcggtagagttcaccactttgaccgagtatttgcatctgctgcgg
gctgcggcccaggcgctcaatccgctaggcccttctgcgatgttttacctggctgcggcc
gtgtcagatttctatattcctgtctctgaaatgcctgaacacaagatccagtcatctggg
ggcccactgcagataacaatgaagatggttccaaaaatgctttttcctttggttaaagac
tgggctcccaaagcatttgtaatttcctttaagctggagactgacccctccatcgtaatt
gatcgtgcacggaatgctttggaagtttatcgacatcaagtggtggtggctaatatcctt
gagtcacgaagatcctttgtggttattgtaactaaagactcagaaactaagttatcgcta
tcagaggaagaagtagaaaaaggtacagagatagaagagaagatagtagttgatcttcag
tctcggcacacagcttttatagaggacaaaaactga

DBGET integrated database retrieval system