KEGG   Hipposideros armiger (great roundleaf bat): 109383617
Entry
109383617         CDS       T04661                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04120  Ubiquitin mediated proteolysis
hai04380  Osteoclast differentiation
hai04630  JAK-STAT signaling pathway
hai04668  TNF signaling pathway
hai04910  Insulin signaling pathway
hai04917  Prolactin signaling pathway
hai04920  Adipocytokine signaling pathway
hai04930  Type II diabetes mellitus
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04935  Growth hormone synthesis, secretion and action
hai05160  Hepatitis C
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109383617 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109383617 (SOCS3)
   04668 TNF signaling pathway
    109383617 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109383617 (SOCS3)
   04920 Adipocytokine signaling pathway
    109383617 (SOCS3)
   04917 Prolactin signaling pathway
    109383617 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    109383617 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109383617 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109383617 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    109383617 (SOCS3)
   04931 Insulin resistance
    109383617 (SOCS3)
  09172 Infectious disease: viral
   05164 Influenza A
    109383617 (SOCS3)
   05160 Hepatitis C
    109383617 (SOCS3)
   05168 Herpes simplex virus 1 infection
    109383617 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hai04121]
    109383617 (SOCS3)
Ubiquitin system [BR:hai04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     109383617 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 109383617
NCBI-ProteinID: XP_019499763
LinkDB
Position
Un
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVSEQPPAQPLPGNPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgccgtgacgggcggcgaggcgaacctgctgctc
agcgcggagcccgcgggcaccttcctgatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtcggggaccaaaaacctgcgcatccagtgcgagggaggc
agcttctcgctgcagagcgacccccggagcacgcagccggtgccccgctttgactgcgtg
ctcaagctggtgcatcactacatgccgcccccgggcgccccttccttcccctcgccaccg
actgaaccctcctccgaggtgtcagaacagccgccagcccagccgcttcctgggaacccc
cccaggagagcctattacatctactccgggggcgagaagatccctctggtgttgagcagg
cctctctcctctaacgtggccactcttcaacatctctgtcgaaagaccgtcaacggccac
ctggactcctatgagaaagtcacccagctgcctggacccattcgggagttcctggaccag
tacgatgccccgctttaa

DBGET integrated database retrieval system