KEGG   Hipposideros armiger (great roundleaf bat): 109383688
Entry
109383688         CDS       T04661                                 

Gene name
GRB2
Definition
(RefSeq) growth factor receptor bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04062  Chemokine signaling pathway
hai04068  FoxO signaling pathway
hai04072  Phospholipase D signaling pathway
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04540  Gap junction
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04630  JAK-STAT signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04714  Thermogenesis
hai04722  Neurotrophin signaling pathway
hai04910  Insulin signaling pathway
hai04912  GnRH signaling pathway
hai04915  Estrogen signaling pathway
hai04917  Prolactin signaling pathway
hai04926  Relaxin signaling pathway
hai04935  Growth hormone synthesis, secretion and action
hai05034  Alcoholism
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109383688 (GRB2)
   04012 ErbB signaling pathway
    109383688 (GRB2)
   04014 Ras signaling pathway
    109383688 (GRB2)
   04630 JAK-STAT signaling pathway
    109383688 (GRB2)
   04068 FoxO signaling pathway
    109383688 (GRB2)
   04072 Phospholipase D signaling pathway
    109383688 (GRB2)
   04151 PI3K-Akt signaling pathway
    109383688 (GRB2)
   04150 mTOR signaling pathway
    109383688 (GRB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109383688 (GRB2)
   04540 Gap junction
    109383688 (GRB2)
   04550 Signaling pathways regulating pluripotency of stem cells
    109383688 (GRB2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109383688 (GRB2)
   04660 T cell receptor signaling pathway
    109383688 (GRB2)
   04662 B cell receptor signaling pathway
    109383688 (GRB2)
   04664 Fc epsilon RI signaling pathway
    109383688 (GRB2)
   04062 Chemokine signaling pathway
    109383688 (GRB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109383688 (GRB2)
   04912 GnRH signaling pathway
    109383688 (GRB2)
   04915 Estrogen signaling pathway
    109383688 (GRB2)
   04917 Prolactin signaling pathway
    109383688 (GRB2)
   04926 Relaxin signaling pathway
    109383688 (GRB2)
   04935 Growth hormone synthesis, secretion and action
    109383688 (GRB2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109383688 (GRB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109383688 (GRB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    109383688 (GRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109383688 (GRB2)
   05206 MicroRNAs in cancer
    109383688 (GRB2)
   05205 Proteoglycans in cancer
    109383688 (GRB2)
   05203 Viral carcinogenesis
    109383688 (GRB2)
   05231 Choline metabolism in cancer
    109383688 (GRB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109383688 (GRB2)
   05225 Hepatocellular carcinoma
    109383688 (GRB2)
   05226 Gastric cancer
    109383688 (GRB2)
   05214 Glioma
    109383688 (GRB2)
   05221 Acute myeloid leukemia
    109383688 (GRB2)
   05220 Chronic myeloid leukemia
    109383688 (GRB2)
   05211 Renal cell carcinoma
    109383688 (GRB2)
   05215 Prostate cancer
    109383688 (GRB2)
   05213 Endometrial cancer
    109383688 (GRB2)
   05224 Breast cancer
    109383688 (GRB2)
   05223 Non-small cell lung cancer
    109383688 (GRB2)
  09165 Substance dependence
   05034 Alcoholism
    109383688 (GRB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109383688 (GRB2)
   05160 Hepatitis C
    109383688 (GRB2)
   05163 Human cytomegalovirus infection
    109383688 (GRB2)
   05165 Human papillomavirus infection
    109383688 (GRB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109383688 (GRB2)
   01522 Endocrine resistance
    109383688 (GRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109383688 (GRB2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hai04990]
    109383688 (GRB2)
Membrane trafficking [BR:hai04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    109383688 (GRB2)
Domain-containing proteins not elsewhere classified [BR:hai04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   109383688 (GRB2)
SSDB
Motif
Pfam: SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH2_2 DUF5093 SH3_4
Other DBs
NCBI-GeneID: 109383688
NCBI-ProteinID: XP_019499869
LinkDB
Position
Un
AA seq 227 aa
MQLASVHCVHGTSRERRVVAIDFTRHGSFIYTLKSEVLNEECDQNWYKAELNGKDGFIPK
NYIEMKPHPWFFGKIPRAKAEEMLNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKV
LRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQ
EDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
NT seq 684 nt   +upstreamnt  +downstreamnt
atgcagttagcttcagttcactgtgtacacggtacgagccgagaaaggagagtggtggcg
atagatttcacacgtcatgggtcattcatctacactttgaagagcgaggttttgaatgaa
gaatgtgatcaaaactggtacaaggcagaactcaatgggaaagatggcttcattcccaag
aattacatagaaatgaaaccacatccgtggttttttggcaaaatccccagagccaaggca
gaagaaatgcttaacaaacagcggcatgatggggccttccttatccgcgagagtgagagt
gctcctggggatttctccctctctgtcaagtttggaaatgacgtgcagcacttcaaggtg
ctccgagatggcgctgggaagtatttcctctgggtggtgaagttcaattctttgaatgag
ctggtggattatcacagatctacgtccgtctccagaaaccagcagatattcctccgggac
atagagcaggtgccacagcaaccaacgtacgtccaagccctctttgactttgatccccag
gaggacggagagctggggttccgtcggggagactttatccacgtcatggataactcagac
cccaactggtggaaaggggcttgccacgggcagacaggcatgttccctcgcaattacgtc
acccccgtgaaccggaacgtctag

DBGET integrated database retrieval system