KEGG   Hipposideros armiger (great roundleaf bat): 109383724Help
Entry
109383724         CDS       T04661                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00052  Galactose metabolism
hai00500  Starch and sucrose metabolism
hai01100  Metabolic pathways
hai04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109383724 (GAA)
   00500 Starch and sucrose metabolism
    109383724 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109383724 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109383724 (GAA)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109383724 (GAA)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109383724 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109383724
NCBI-ProteinID: XP_019499945
LinkDB All DBs
Position
Un
AA seq 946 aa AA seqDB search
MDLKWPPCPRPLLGVCALLSLATAALLAHVLLHDFTVVPRELRDFSQVPKEMYQARRQGA
SGPEPQPGLGAAPTQCDMPPNSRFDCAPDKAITREQCEARGCCYVPAGWRPRGAQMGQPW
CFFPPSYPSYKLGNLTTTETGYTATLTRDTPTFFPKDILTLRLDVLVETESRLHFTIRDP
ASRRYEVPLETPRVRSQAPSTLYSVEFSEEPFGIVVRRKLDGRVVLNTTVAPLFFTDQFL
QLSTSLPSPYITGLAEHLGPLMLNTNWTKVTLWNRDIPPTPDVNLYGSHPFYLVLEDGGL
AHGVFLLNSNAMDVVLQPSPALSWRSTGGILDMYVLLGPEPKSVVRQYLDIVGYPFMPPY
WGLGFHLCRWGYSSTAITRQVVENMTRANFPLDVQWNDLDYMDARRDFTFNTDGFGDFPA
MVQELHQGGRRYVMIVDPAISSSGPPGSYRPYDEGLRRGVFITNETGQPLIGKVWPGPTA
FPDFTNPEALDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPDSDLENPPYVPG
VVGGTLRAATICASSHQFLSTHYNLHNLYGLTEALASHRALVKARGTRPFVISRSTFAGH
GRYAGHWTGDVWSSWEQLSSSVPEVLLFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGA
FYPFTRNHNDLRSLPQEPYRFSDSAQQAMRTALALRYALLPHLYTLFHRAHAGGETVARP
LFLEFPEDPRTWNVDRQLLWGEALLITPVLEAGQVEVTGYFPAGTWYSLQTVPVGAFGSL
PPPPPAPLKSAIHSEGQWVTLPAPLDTINLHLRAGHIIPLQGPGLTTTESRQQPMALAVA
LTGSGEAQGELFWDDGESLGVLERGAYTQVVFLARNNTVVNKLLHVTREGAGLQLRRVTV
LGVATAPQQVVANGVPVSNFTYSPNTQTLGIPVSLAMGEQFLISWS
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaagtggccaccctgcccccgccccctgctgggggtctgtgccctcctctcc
ttggccaccgctgccctcttggcacatgtcctgctccacgacttcacggtggtcccccga
gagctgcgtgacttctcccaagtacccaaggagatgtaccaagctcgtcggcagggagcc
agcggcccagagccccagcccggcctgggagcagcgcccacacagtgtgacatgcccccc
aacagccgctttgactgcgccccagacaaagccatcacccgggagcagtgcgaggcccgc
ggctgctgctacgtgcctgcgggatggcgacctcggggcgctcagatgggacagccttgg
tgcttcttcccgcccagctacccgagttataagctggggaacctgaccaccacggagacg
ggctacacagccaccctgacccgagacaccccgaccttcttccccaaggacatcctgacc
ttacggctggacgtgctggtggagactgagagccgactccacttcacgatcagagatcct
gccagcaggcgctacgaggtgcccttggagaccccgcgtgtccgcagccaggcgccatcc
acgctttacagcgtggagttctccgaggagccctttgggatagtcgtgcggcggaagctg
gacggacgggtggtgctgaacaccacggtggccccgttgttcttcaccgaccagtttctg
cagctatccacctccctgccgtccccgtatatcaccggcctcgccgagcacctcggccct
ctgatgctcaacaccaactggaccaaggttaccctctggaaccgggatatcccgcccacg
cccgacgtgaacctgtacgggtcccaccctttctacctggtgctggaggacggcgggttg
gctcatggggtcttcctcctgaacagcaacgccatggatgtggtcctgcagccgagccca
gccctcagctggaggtcaacaggcgggatcctggacatgtacgtcttgctgggcccggag
cccaagagcgtggtgcggcagtacctggacatcgtgggctacccgttcatgccgccttac
tggggcctgggcttccacctctgtcgctggggctactcgtccactgccatcacccgccag
gtggtggagaacatgaccagggccaacttccccctggacgtccagtggaacgacctggac
tacatggacgccaggagggacttcactttcaacacggatggctttggggatttcccagcc
atggtgcaggagctccaccagggcggccggcggtacgtgatgatcgtggatcccgctatc
agcagctccggcccccctgggagctaccgaccctacgatgagggtctgaggaggggcgtt
ttcatcaccaatgagaccgggcagccactgattgggaaggtgtggccgggacccaccgcc
ttccctgacttcaccaaccccgaggccctcgactggtggcaggacatggtggccgagttc
cacgcccaggtgcccttcgacggcatgtggattgacatgaacgagccgtccaacttcgtg
aagggctccgtggacggctgccccgacagtgacctggagaacccgccctacgtgccaggg
gtggttggtgggaccctccgggcagccaccatctgtgcctccagccaccagttcctctcc
acgcactacaacctgcacaacctgtatggcctgacggaagccttggcctcccacagggcc
ctggtgaaggctcgggggacgcgtcccttcgtgatctcccgctcaaccttcgccggccat
ggccggtatgccggccactggacaggggacgtgtggagcagctgggagcagctgtcctcc
tccgtaccagaagtcctgctcttcaacctgctgggggtgcccctggtgggggccgatgtc
tgcggcttcctgggcaacacctcggaggagctgtgcgtgcgctggacccagctgggggcc
ttctaccccttcacgcggaaccacaacgacctgcgcagcctgcctcaggagccgtacagg
ttcagcgactctgcgcagcaggccatgaggacggccctcgccctgcgctatgcgctgctg
ccccacctctacacgctgttccaccgggcccacgccgggggcgagaccgtggcccggccc
ctcttcctggagttccccgaggacccccgcacctggaacgtggaccgccagctcctgtgg
ggggaggcccttctcatcacgccggtgctcgaggccgggcaggttgaagtgactggctac
ttccccgccggcacgtggtacagcctgcagacggtgccagtcggggccttcggcagcctc
ccgcctccacctccagcacctctcaagtctgccatccacagcgagggacagtgggtgacg
ctgccagcccccctggacaccatcaatctccacctccgggctgggcacatcatccccctg
cagggccccggcctgaccaccacggagtcccgccagcagcccatggccctggccgtggcc
ctgacggggagcggggaggcccaaggggagctcttctgggacgacggggagagcctgggg
gtgctggagcgcggggcctacacacaggtcgtcttcctggccaggaacaacacggtcgtg
aacaagctgctgcacgtgacccgtgagggggccggcctgcagctgaggagggtgaccgtc
ctgggcgtggccacggccccccagcaggtcgtagccaatggtgttcctgtctccaacttc
acctacagccccaacacccagaccctgggcatccctgtgtcgctggcgatgggagagcag
tttctcatcagttggtcttaa

DBGET integrated database retrieval system