KEGG   Hipposideros armiger (great roundleaf bat): 109383826
Entry
109383826         CDS       T04661                                 

Gene name
MAVS
Definition
(RefSeq) mitochondrial antiviral signaling protein
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05164  Influenza A
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109383826 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    109383826 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    109383826 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109383826 (MAVS)
   05164 Influenza A
    109383826 (MAVS)
   05161 Hepatitis B
    109383826 (MAVS)
   05160 Hepatitis C
    109383826 (MAVS)
   05168 Herpes simplex virus 1 infection
    109383826 (MAVS)
   05169 Epstein-Barr virus infection
    109383826 (MAVS)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 109383826
NCBI-ProteinID: XP_019500141
LinkDB
Position
Un
AA seq 488 aa
MTFAEDKTFDYIRHNYRKFYRIRVIEILPQLSCLTPSDQDLLRASLERKGNQNTIWDLFD
SLHRRCGWVESLIRALRYCELVDLADEVAHVYQSNLPSNQNHPAAPLELPSVPAEAPGRS
TPAVAPSALNNSYRDEEPSYPMPVQDTQSPESSGESSMKTPQTSSSGAILSRPSGPLEPS
SDMAVRSPLPSSVPQEQDTELGSAHTAGMVPSITSPHGPVSPTVSFQPLARSTPRASCLP
GPPVSAVSTGTTSSSTGLPSEQGAGDQAEAIICTSGAGVPNNSMTTSTAPSKVPPHSAFT
NTVPSKLPTSSKPSGIMPTNVWGCPTWLVPLPHPVPSILFFLYQDTPVSPAPTVATTGGS
SPRADSSFDSLSSGLELSKPGRLVSRMDSQPFSGCSADLAISYSDNLDAGPHNAPEENEY
VSVRIHVEEAPSIDNLSGNPGPHATQQTRGEEESPCVGWAPLAPWLGVAAAGALLATLLA
VLNRRRLL
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgacgtttgccgaggacaagactttcgactatatccgccataattaccgaaaattttac
cgtattcgtgtaatagagattctgcctcaactgtcttgcctcacaccaagtgaccaggac
ctactgcgagccagcttggaacgcaaggggaaccagaacaccatctgggacctcttcgac
agccttcaccgccggtgtggctgggtggaatccctcatccgggcactgaggtattgtgag
ctggttgatcttgctgacgaagtggcccacgtctaccagagcaacctgccctcgaaccag
aatcaccccgctgccccgctggagctgccatcagttcctgctgaggctccagggcgctcc
acacctgctgtggcccccagtgccctcaacaacagctacagagacgaggagccaagttat
cccatgcctgtccaagacacccagtcaccagagtcctcgggagagagctcaatgaagacc
ccacagacatccagctctggggctatactgagtaggcccagtggccctctggagccctcc
tctgacatggcagtccgcagtcctctgccctccagtgtgcctcaggagcaggacacagaa
ctgggcagtgcccacacagcaggcatggtccctagcatcacatcaccccatgggcctgtg
tctccgactgtctccttccaacccctggcccgttccacccccagggcaagctgcttgcct
ggacccccagtgtcagctgtgtctacgggcaccacctcctcctccactggcttgccctct
gaacagggtgctggtgaccaggctgaggctatcatctgcaccagtggggcaggtgtgccc
aacaattctatgaccaccagcacagcgccctccaaggtgcccccccactcagcatttacc
aacacagtgccttccaagttgcccaccagctcaaagccctctggtataatgcccaccaat
gtgtggggctgcccaacctggcttgtccccctaccacacccagtcccttccattctcttc
tttctttatcaggacactccagtgtctccagctcccacagttgccaccactggaggcagc
tcaccccgtgcagacagtagctttgacagcttgagctcagggctagagctgagcaagcca
ggcaggctggtatcccggatggacagccagccattttctggctgctccgcggaccttgcc
atcagctacagtgacaacttggacgcaggacctcacaatgctccggaggagaatgaatat
gtgtcagtgaggatccacgtggaggaggctcccagcatagacaacctgtccggcaaccct
gggccacatgccacccagcagacccggggggaggaggagtccccctgcgtcgggtgggcc
cccttggctccgtggcttggggtggctgctgctggggcactcctggccacgctcctggcc
gtgctgaaccggcggcgcctcctctag

DBGET integrated database retrieval system