KEGG   Hipposideros armiger (great roundleaf bat): 109383860
Entry
109383860         CDS       T04661                                 

Gene name
NFKBIA
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04064  NF-kappa B signaling pathway
hai04210  Apoptosis
hai04380  Osteoclast differentiation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04625  C-type lectin receptor signaling pathway
hai04657  IL-17 signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04668  TNF signaling pathway
hai04722  Neurotrophin signaling pathway
hai04920  Adipocytokine signaling pathway
hai04926  Relaxin signaling pathway
hai04931  Insulin resistance
hai05132  Salmonella infection
hai05134  Legionellosis
hai05135  Yersinia infection
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05215  Prostate cancer
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109383860 (NFKBIA)
   04668 TNF signaling pathway
    109383860 (NFKBIA)
   04024 cAMP signaling pathway
    109383860 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109383860 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109383860 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    109383860 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    109383860 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    109383860 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    109383860 (NFKBIA)
   04660 T cell receptor signaling pathway
    109383860 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    109383860 (NFKBIA)
   04659 Th17 cell differentiation
    109383860 (NFKBIA)
   04657 IL-17 signaling pathway
    109383860 (NFKBIA)
   04662 B cell receptor signaling pathway
    109383860 (NFKBIA)
   04062 Chemokine signaling pathway
    109383860 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109383860 (NFKBIA)
   04926 Relaxin signaling pathway
    109383860 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109383860 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109383860 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109383860 (NFKBIA)
   05203 Viral carcinogenesis
    109383860 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109383860 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109383860 (NFKBIA)
   05215 Prostate cancer
    109383860 (NFKBIA)
   05222 Small cell lung cancer
    109383860 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109383860 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109383860 (NFKBIA)
   05135 Yersinia infection
    109383860 (NFKBIA)
   05134 Legionellosis
    109383860 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109383860 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    109383860 (NFKBIA)
   05162 Measles
    109383860 (NFKBIA)
   05164 Influenza A
    109383860 (NFKBIA)
   05161 Hepatitis B
    109383860 (NFKBIA)
   05160 Hepatitis C
    109383860 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    109383860 (NFKBIA)
   05163 Human cytomegalovirus infection
    109383860 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109383860 (NFKBIA)
   05169 Epstein-Barr virus infection
    109383860 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109383860 (NFKBIA)
   05140 Leishmaniasis
    109383860 (NFKBIA)
   05142 Chagas disease
    109383860 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109383860 (NFKBIA)
   04131 Membrane trafficking [BR:hai04131]
    109383860 (NFKBIA)
Transcription factors [BR:hai03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    109383860 (NFKBIA)
Membrane trafficking [BR:hai04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109383860 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 109383860
NCBI-ProteinID: XP_019500204
LinkDB
Position
Un
AA seq 314 aa
MFHPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEDYEQMVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDVAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCGTQHLHPILQATN
YKGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTPKNLQMLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcaccccgccgagcacgcccaggactgggccatggagggccctcgggacgcgctc
aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gactatgagcagatggtgaaggaactgcgggagatccgcctggagccgcaggaggcgccg
cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccatgaggagaaggcactgactatggaagtggtccgccaagtgaagggagac
gtggcctttcttaacttccagaacaacctgcagcagactccactccacttggctgtgatt
actaaccagccagaaattgctgaggcacttttggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg
ggagtcctgactcaaagctgtgggacccagcatctccaccctatcctgcaggccaccaac
tataaaggccacacgtgtctgcacttagcctctatccatggctacctgggcatcgtagag
cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggcagaactgcg
cttcatctcgcggtggacctacagaatcctgacctggtgtcgctcttgttgaagtgtggg
gctgacgtcaacagagtcacctaccagggctactctccgtatcagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccagctgaccccaaaaaaccttcagatgctg
ccagagagtgaggatgaggagagctatgatacggagtcagagttcacagaggatgagctg
ccatatgatgactgtgtgcttggaggccagcgcctgacattatga

KEGG   Hipposideros armiger (great roundleaf bat): 109395326
Entry
109395326         CDS       T04661                                 

Gene name
NFKBIB
Definition
(RefSeq) NFKB inhibitor beta
  KO
K02581  NF-kappa-B inhibitor beta
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04062  Chemokine signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04722  Neurotrophin signaling pathway
hai04920  Adipocytokine signaling pathway
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05162  Measles
hai05164  Influenza A
hai05169  Epstein-Barr virus infection
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109395326 (NFKBIB)
   04622 RIG-I-like receptor signaling pathway
    109395326 (NFKBIB)
   04623 Cytosolic DNA-sensing pathway
    109395326 (NFKBIB)
   04660 T cell receptor signaling pathway
    109395326 (NFKBIB)
   04658 Th1 and Th2 cell differentiation
    109395326 (NFKBIB)
   04659 Th17 cell differentiation
    109395326 (NFKBIB)
   04662 B cell receptor signaling pathway
    109395326 (NFKBIB)
   04062 Chemokine signaling pathway
    109395326 (NFKBIB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109395326 (NFKBIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109395326 (NFKBIB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109395326 (NFKBIB)
  09172 Infectious disease: viral
   05162 Measles
    109395326 (NFKBIB)
   05164 Influenza A
    109395326 (NFKBIB)
   05169 Epstein-Barr virus infection
    109395326 (NFKBIB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109395326 (NFKBIB)
   05140 Leishmaniasis
    109395326 (NFKBIB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109395326 (NFKBIB)
Transcription factors [BR:hai03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    109395326 (NFKBIB)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_5 Ank_4
Other DBs
NCBI-GeneID: 109395326
NCBI-ProteinID: XP_019521777
LinkDB
Position
Un
AA seq 354 aa
MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGPELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFAAGTEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGL
LVAERGGHTALHLACRVGEHTCARVLLQPRPQRPRGAPSTYLAQSPDRAPDTDHTSVALY
PEPDLEKEEDENEEDWKLQLEAENYEGHTPLHVAVIHKDAEMARLLWEAGADLNKPEPTC
GRSPLHLAVEAQASDVLELLLKAGADPAARMYGGRTPLGSATLRPNPVLVRLLRAHGSPE
PEDEDDKPGPCSSSSDSDSGDEGDEYDDIVVHSGRSPNRLPLTPASKPLPDDPV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggccggggtcgcgtgcttggggaaagctgcggatgccgacgaatggtgcgacagcggc
ttgggctctctgggtcccgacgcagcagccccaggaggaccaggactgggtccggagctg
ggcccggggctgtcgtgggcacccctcgtcttcggctacgtcactgaggatggagacacg
gcactgcacttggcagtgattcatcagcatgagcccttcctggatttcctcctaggcttc
gcggctggaactgaatacctggacctgcagaatgacctgggccagaccgccctgcacctc
gcagccattctgggggaggcatccacagtagagaagttgtatgcggctggcgccgggttg
ctcgtggcagagcgtgggggccacacagcgctgcatctggcctgccgcgtgggggagcac
acctgtgctcgtgttttgctccagccccgcccccagcgccccaggggagcccccagtacc
tacctcgctcagagccctgaccgtgcccctgacaccgaccacacttctgttgccttgtac
cctgaacctgacttggagaaggaagaggatgagaatgaggaggactggaagctgcaactg
gaggctgaaaactatgagggccacaccccactccatgtggctgtcatccacaaagatgca
gagatggcccgactactctgggaggctggagctgacctcaacaaaccggagcccacgtgc
ggccggagccccctgcacttggcagtggaggcccaagcgtctgatgtgctggagctactc
ctgaaggcgggtgccgaccctgctgcccgcatgtacggtggccgcaccccactgggcagt
gccacactccgacccaaccccgtcctcgtccgcctcctccgtgcacatggatcccctgag
cccgaggacgaggacgacaagcctggcccctgcagcagcagtagcgacagcgacagcggg
gacgagggcgatgaatatgacgacatcgtggtccacagtggccggagcccaaaccggcta
cctcttaccccagcctcaaaacctctccctgatgatcccgtctga

DBGET integrated database retrieval system