KEGG   Hipposideros armiger (great roundleaf bat): 109384009Help
Entry
109384009         CDS       T04661                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00052  Galactose metabolism
hai00500  Starch and sucrose metabolism
hai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109384009 (GANC)
   00500 Starch and sucrose metabolism
    109384009 (GANC)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109384009 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109384009
NCBI-ProteinID: XP_019500448
LinkDB All DBs
Position
Un
AA seq 983 aa AA seqDB search
MEAAKKEEISVEDEAVDNDVFKNCSKIAFYRRQKQQLSKKSTYRALLDSVTTDKDSTKFQ
IINEATKEKKPQSRGTYGISAQDSTWPRMELRGPTSKGKLPRMSATWLSRPRTLRTPWNG
LHFQPVCRFSTETTLLAASLKVPLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTSKP
STVRLLSCSGDTGSLVLADGKGNLKCHITANPFKVDLVSEEEVVMNINLLGQLYFEHLQV
PLKQRTTKENEEDASVDTSQQKQEDLGLWEEKFRNFVDVKVNGPTSIGLDFSLHGFEYLY
GIPQHAESHQLKNTSDGDAYRLYNLDVYGYKIYDKKGIYGSVPYLLAHKQGRTLGIFWLN
SSETLVEINTEPQVKMGPVAAKQEVRPRTDVHWMSESGIIDVFLLIGPTPCDVFKQYSSL
TGTQAMPPLFSLGYHQCRWNYEDEQDVKAVDAGFDKHDIPYDVIWLDIEHTEGKRYFTWD
KKRFPNPERMQELLQNKKRKLVVISDPHIKIDPDYSVYAKAKEQGFFVRNHEGGDFEGVC
WPGLSCYLDFTNPKVREWYSRLFAFSAYQGSTDILYIWNDMNEPSVFRGPEQTMQKNAIH
HGNWEHRELHNIYGFYQQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNRAK
WSYLKISIPMLLTLNVTGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATIKTK
RREPWLFGEEHTRLIREAIRERYALLPYWYSLFYRAHVASEPIMRPLWVEFPDELETFGV
EDEYMLGCALLVHPVTEPKATVIDVFLPGRNEVWYDSKTFAHWEGACTVKIPVALDSIPV
FQRGGSIVPIKTRIGKSTGWMTDFPYGLRVALSTKGSAVGELYLDDGHSFRYLHQKQFLH
RKFSFSSGVLTNSYADKSGHYPSKCVVEQISVLGLKEQPSSVTTHSSDGNNQSVAFTYCA
KTSSLSLEKLSLNIGADWEVHFK
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagccaaaaaggaggaaatcagtgttgaagatgaagctgtggataacgacgtt
ttcaaaaactgcagcaagattgctttctataggcgtcagaaacagcagctgtccaagaag
tccacctatcgggcattactagactcagtcacaacagacaaagatagcaccaagttccaa
atcatcaatgaagcaactaaggaaaagaagccacagtccagggggacctatgggatctca
gcacaagacagcacatggcccagaatggagctgaggggcccaacaagcaagggcaagtta
cccaggatgtcagcaacatggctctcaagaccgagaactttgaggaccccttggaacgga
ctccattttcagcctgtttgcaggttttcaacagagacaacacttctagcagcttctcta
aaggttcctcttttggctgaagtttatggtatagagggaaatattttcaggcttaaaatc
aatgaagaaactcctctgaagcccaggtatgaagtccccgatgtcctcacaagtaagcca
agcactgtaaggctgctttcatgctctggggatacaggcagtttggtactagcagatgga
aaaggaaatcttaagtgtcatatcacagcaaacccattcaaggttgacttggtgtctgaa
gaagaggttgtgatgaacataaacttgctaggccaattatactttgagcatctgcaggtt
cctctcaagcaaagaactaccaaagaaaatgaagaggatgcatcagttgacacctctcag
caaaaacaagaggatctgggcctgtgggaggagaaattcagaaattttgtggacgttaaa
gttaacggtcctacatccattggtttggatttctccttgcatggatttgagtatctctat
gggatcccgcaacatgcagagtcacaccaacttaaaaatactagtgatggggatgcttac
cgcctttataacctggatgtctatggatataaaatatatgacaaaaagggaatttatggt
tctgtgccttatctcctggcccacaaacagggcaggactttgggcattttttggctgaat
tcctcagaaacactggtggagatcaatacagagcctcaggtaaagatgggcccagttgct
gctaaacaagaggtcagacctcgaactgatgtgcactggatgtcagagagtggaatcatt
gacgtttttctgctgataggacctacaccttgtgacgtcttcaagcagtactcatccctt
acaggcacacaagccatgccccctctcttctccttggggtaccatcagtgccgctggaac
tatgaagatgagcaggatgtaaaagcagtggatgcaggatttgacaaacatgacattcct
tacgatgtcatatggttggacatagagcacactgagggcaaaaggtacttcacctgggac
aagaaaagattcccaaaccccgaaaggatgcaagagctgctccagaacaaaaaacgtaag
cttgtggtcatcagtgacccccacatcaagattgaccctgactactcagtgtatgctaag
gccaaagaacagggcttctttgtgagaaatcatgaaggaggagactttgaaggggtgtgc
tggcctggactctcctgttacctggatttcaccaatcccaaagtcagagaatggtattca
agactttttgctttctctgcttatcagggatctactgacatcctctacatatggaatgac
atgaatgagccttctgtctttagagggccagagcaaaccatgcagaagaatgccattcat
catggcaactgggagcacagagaacttcacaacatctatggtttttatcagcaaatggct
actgcagaaggattgatacaacgatctaagggaaaggagagaccctttgttcttacacgt
tctttctttgctggatcacaaaagtatggtgctgtgtggacaggagacaacagagcaaaa
tggagttacctgaaaatttctatccctatgttactcactctcaacgttactgggatctct
ttttgtggagctgatgtaggcggcttcatcgggaatccagaggcagagctgctagtacgt
tggtaccaggccggagcctaccagcccttctttcgtggccatgccaccataaagacaaag
cgacgggaaccttggctcttcggggaggaacacacccggctcatcagagaagccatcaga
gagcgctacgcccttctgccctattggtattctctgttctaccgcgcacacgtggcttcc
gaacccatcatgaggcctctgtgggtagagtttcctgatgaattagagacttttggtgtg
gaagatgaatacatgctgggatgtgctttattggttcatccggtcacagagccaaaagct
actgtgattgatgtgtttctgccgggacgaaatgaggtctggtatgactctaagacattt
gctcattgggaaggagcatgtactgtgaagatcccagtagccttggactctataccagtg
tttcaacgaggtggaagtatagtaccaataaagacaaggataggaaaatccacaggctgg
atgactgatttcccatatgggctccgagtggctctaagcactaagggttctgctgtgggt
gaattatatctcgacgatggccattcattccgataccttcaccagaagcaattcttgcac
aggaagttttcattctcttcaggtgttttgaccaacagttatgctgacaagagtggtcat
tatcccagcaagtgtgtggtggagcagatatctgtcctaggcctcaaggagcagccgtcg
tctgtgaccacccattcatctgatggtaataatcagtctgtggcttttacatattgtgcc
aaaacgtcctccttgagcctggagaagctctcactgaacattggcgctgactgggaggta
cactttaaatga

DBGET integrated database retrieval system