KEGG   Hipposideros armiger (great roundleaf bat): 109384251
Entry
109384251         CDS       T04661                                 

Gene name
FOSL1
Definition
(RefSeq) FOS like 1, AP-1 transcription factor subunit
  KO
K04502  fos-like antigen 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04310  Wnt signaling pathway
hai04380  Osteoclast differentiation
hai04657  IL-17 signaling pathway
hai05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109384251 (FOSL1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    109384251 (FOSL1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109384251 (FOSL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109384251 (FOSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109384251 (FOSL1)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    109384251 (FOSL1)
SSDB
Motif
Pfam: DUF3450 DivIC Prefoldin_2 Tektin MCC-bdg_PDZ
Other DBs
NCBI-GeneID: 109384251
NCBI-ProteinID: XP_019500997
LinkDB
Position
Un
AA seq 274 aa
MFRDFGEPGPSSGAGGAYGGPAQPPATGQQQFHFVPSINAVSGSQELQWMVQPHFLGPSN
YPRPLAYPQYSYPQPRPGVIRALGPPPGVRRRPSEQSGGGGAPSSEARAEQASRSQVQEP
EEGTDRLPAGGEQWSETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGTKE
SGTGRTGGTRGTSSPPSSSGPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTY
PSTPEPCASAHRRSSSSSGDPSSDPLGSPTLLAL
NT seq 825 nt   +upstreamnt  +downstreamnt
atgttccgagacttcggggaacccggaccgagttccggggccggcggtgcgtacggcggc
ccggcgcagcccccggcgacaggccagcagcagttccacttcgtgccaagcatcaatgct
gtgagtggcagccaggagctgcagtggatggttcagcctcacttcctgggacccagcaac
taccccaggcctttggcctatccccagtacagctacccacaaccccggccaggagtcatc
cgggccctggggccacctccaggggtacgtcgccggcccagtgaacagtccggaggagga
ggagcgccgtcgagtgaggcgcgagcggaacaagctagccgcagccaagtgcaggaaccg
gaggaaggaactgaccgacttcctgcaggcggtgagcagtggtcggagactgacaaactg
gaagacgagaaatcagggctgcagcgagagattgaggagctgcagaagcagaaggagcgg
ttggagctggtgctcgaagcccaccgccccatctgcaaaatcccggaagggaccaaggag
agtggcactggccgcacaggcggcaccaggggcaccagcagcccaccatcctcttccggc
cctgtgccttgtatctccctttccccagggcctgttcttgaacccgaagcattgcacacc
cccacgctcatgaccacaccctccctgactcctttcacccccagtctggtcttcacctac
ccaagcactcctgaaccctgtgcctcagcccatcgcaggagtagcagcagcagtggggat
ccgtcctctgatcccctcggctcccccaccctcctggctttatga

DBGET integrated database retrieval system