KEGG   Hipposideros armiger (great roundleaf bat): 109384322
Entry
109384322         CDS       T04661                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01523  Antifolate resistance
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04064  NF-kappa B signaling pathway
hai04066  HIF-1 signaling pathway
hai04071  Sphingolipid signaling pathway
hai04137  Mitophagy - animal
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04218  Cellular senescence
hai04380  Osteoclast differentiation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04622  RIG-I-like receptor signaling pathway
hai04623  Cytosolic DNA-sensing pathway
hai04625  C-type lectin receptor signaling pathway
hai04657  IL-17 signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04668  TNF signaling pathway
hai04722  Neurotrophin signaling pathway
hai04917  Prolactin signaling pathway
hai04920  Adipocytokine signaling pathway
hai04926  Relaxin signaling pathway
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai05010  Alzheimer disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05030  Cocaine addiction
hai05132  Salmonella infection
hai05133  Pertussis
hai05134  Legionellosis
hai05135  Yersinia infection
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05146  Amoebiasis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05203  Viral carcinogenesis
hai05212  Pancreatic cancer
hai05215  Prostate cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05222  Small cell lung cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05321  Inflammatory bowel disease
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109384322 (RELA)
   04014 Ras signaling pathway
    109384322 (RELA)
   04064 NF-kappa B signaling pathway
    109384322 (RELA)
   04668 TNF signaling pathway
    109384322 (RELA)
   04066 HIF-1 signaling pathway
    109384322 (RELA)
   04071 Sphingolipid signaling pathway
    109384322 (RELA)
   04024 cAMP signaling pathway
    109384322 (RELA)
   04151 PI3K-Akt signaling pathway
    109384322 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109384322 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    109384322 (RELA)
   04218 Cellular senescence
    109384322 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109384322 (RELA)
   04621 NOD-like receptor signaling pathway
    109384322 (RELA)
   04622 RIG-I-like receptor signaling pathway
    109384322 (RELA)
   04623 Cytosolic DNA-sensing pathway
    109384322 (RELA)
   04625 C-type lectin receptor signaling pathway
    109384322 (RELA)
   04660 T cell receptor signaling pathway
    109384322 (RELA)
   04658 Th1 and Th2 cell differentiation
    109384322 (RELA)
   04659 Th17 cell differentiation
    109384322 (RELA)
   04657 IL-17 signaling pathway
    109384322 (RELA)
   04662 B cell receptor signaling pathway
    109384322 (RELA)
   04062 Chemokine signaling pathway
    109384322 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109384322 (RELA)
   04917 Prolactin signaling pathway
    109384322 (RELA)
   04926 Relaxin signaling pathway
    109384322 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109384322 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109384322 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    109384322 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109384322 (RELA)
   05202 Transcriptional misregulation in cancer
    109384322 (RELA)
   05203 Viral carcinogenesis
    109384322 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109384322 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109384322 (RELA)
   05221 Acute myeloid leukemia
    109384322 (RELA)
   05220 Chronic myeloid leukemia
    109384322 (RELA)
   05215 Prostate cancer
    109384322 (RELA)
   05222 Small cell lung cancer
    109384322 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109384322 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109384322 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    109384322 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    109384322 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109384322 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109384322 (RELA)
   04931 Insulin resistance
    109384322 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109384322 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109384322 (RELA)
   05135 Yersinia infection
    109384322 (RELA)
   05133 Pertussis
    109384322 (RELA)
   05134 Legionellosis
    109384322 (RELA)
   05152 Tuberculosis
    109384322 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109384322 (RELA)
   05170 Human immunodeficiency virus 1 infection
    109384322 (RELA)
   05162 Measles
    109384322 (RELA)
   05164 Influenza A
    109384322 (RELA)
   05161 Hepatitis B
    109384322 (RELA)
   05160 Hepatitis C
    109384322 (RELA)
   05168 Herpes simplex virus 1 infection
    109384322 (RELA)
   05163 Human cytomegalovirus infection
    109384322 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109384322 (RELA)
   05169 Epstein-Barr virus infection
    109384322 (RELA)
   05165 Human papillomavirus infection
    109384322 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109384322 (RELA)
   05145 Toxoplasmosis
    109384322 (RELA)
   05140 Leishmaniasis
    109384322 (RELA)
   05142 Chagas disease
    109384322 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109384322 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109384322 (RELA)
Transcription factors [BR:hai03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    109384322 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Fimbrial_CS1
Other DBs
NCBI-GeneID: 109384322
NCBI-ProteinID: XP_019501146
LinkDB
Position
Un
AA seq 580 aa
MAALGPREPCREPPRCLPPLLRGWALRRERPAGWWRGAGQALRGLYPLIFPSEPVQASGP
YVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTK
DPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNN
PFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLSPVLSHPIFDNRAPNTAELKICRV
NRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYAD
PRLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFN
GPSDPRPPPRRIAVPSRSSTTVPKPAPQPYPFPPSLSTINFEEFSPMGFSSGQIPGQTSA
LAPAPSMTSALVSAPAPVPVLDLGLTQAMAPPAPKPTQAGEGTLTEALLQLQFDADEDLG
ALLGNNADPAVFTDLASVDNSEFQQLLNQGVSMTPHTAEPMLMEYPEAITRLVTGSQRPP
DPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggctgcactgggaccgcgggaaccgtgccgagagcctccgcgctgccttccgcccctt
ctgcgcggatgggcgctgcgcagggagcggccggccggatggtggcgtggggcggggcag
gcgttgaggggcctgtaccccctcatcttcccctcagagccagtccaggcctctggcccc
tatgtggagatcatcgagcagcccaagcagcggggtatgcgcttccgctacaaatgtgag
ggtcgctcagcaggcagtatcccaggcgagaggagcacagataccaccaagacccacccc
accatcaagatcaatggctacacggggccagggacagttcgcatctccctagtcaccaag
gacccccctcaccggcctcaccctcacgagctcgtggggaaagactgccgggatggcttc
tatgaggctgagctctgcccggaccgctgcatccacagcttccagaacctggggatccag
tgtgtaaagaagcgggacctggagcaggccatcagtcagcgcatccagaccaacaacaac
cccttccaagttcccatagaagagcagcgtggggactatgatttgaatgctgttcggctc
tgcttccaggtgacagtgcgggacccatcaggcagacccctccgcctgtcacctgtcctc
tctcatcccatctttgacaaccgcgcccccaacacagcggagctgaagatctgccgagtg
aaccgaaactcggggagctgcctcggcggggatgagatcttcctgctgtgtgacaaggtg
cagaaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttt
tcgcaagccgacgtacaccgacaagtggccattgtgttccggacacctccctatgcagac
cccaggctgcaggctcctgtgcgtgtctcgatgcagctacggaggccttcggatcgggag
ctcagtgagcccatggaattccagtacttgccagacacagatgatcgtcaccggattgag
gagaaacgcaaaaggacatacgagaccttcaagagcatcatgaaaaagagtcctttcaat
ggacccagcgatccccggcctcctccccggcgtattgctgtgccttcccgcagctcaact
accgtccccaagccagctccccagccctatccctttccgccatccctcagcaccatcaac
tttgaggagttttcccccatgggcttttcttctgggcagatcccaggccagacctcggcc
ttggcaccagccccttccatgacatcagccctggtttcggccccagcccctgtcccagtc
ctagacctaggcctgactcaggctatggccccgcctgctcccaagcccacccaggctggg
gaagggacactgacagaggccctgctacagctccagtttgatgctgatgaagacctaggg
gccctgctcggcaataacgccgacccagccgtgttcacggacctggcatcggtcgacaac
tctgagtttcagcagctgctgaaccagggtgtatctatgaccccccacacagcagagccc
atgctgatggagtaccctgaggctataactcgcctggtgacagggtcccagaggccccct
gacccagctcccgctccccttggggcctctgggctccccaacggcctcctctcaggagat
gaagacttctcctccatcgcagacatggacttctcagcccttctgagtcagatcagctcc
taa

DBGET integrated database retrieval system