KEGG   Hipposideros armiger (great roundleaf bat): 109384367Help
Entry
109384367         CDS       T04661                                 

Gene name
TGM6
Definition
(RefSeq) transglutaminase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
KEGG Orthology (KO) [BR:hai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109384367 (TGM6)
Enzymes [BR:hai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109384367 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 109384367
NCBI-ProteinID: XP_019501223
LinkDB All DBs
Position
Un
AA seq 706 aa AA seqDB search
MAGIRITEVDWQWLRNGAAHHTQEYPSPELVVRRGQMFTLVLELNCPLDSKETLIFTVET
GPQASEALHTKAVFQIAELEVGDSWMAVKEAQTENTVTVSLTSPPNAVIGRYLLSARISS
RRKHSNRKLGEFVLLFNPWCPEDDVFLASEEERQEYVLNDNGIIFRGVEKHIRAQGWNFG
QFEEDILNICLSILDRSPSHQDDPAIDVSCRHDPVYVTRIISAMVNSNNDRGVVQGQWQG
KYGGGTSPLHWRGSVAILHKWFKGRFKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNS
AHDTDRNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQ
EESEGIFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWNEDESRERVYSDTKKI
GRCISTKAVGSDSRVDITGLYKYPEGSRKERQVYRKAVRKLFSVEASGRRARVRRIGGRG
LWRDDLLEPATKPSITGKFKVLEPPVLGHDLKLALCLTNLTSRAQRIRVNLSGATILYTR
RPVAEILHESRTVRLGPEEEKKMPIKISYSQYKGDLTEDKKILLAAMCIVIKGEKLLVEK
DITLEDFIAIKVLGPAMVGVAVTVEVMVVNPLLERVENCMLMVEGSGLLQGQLSIKVPSL
EPQQSALVQFNITPSKSGPRQLQVDLVSPHFSDIKGFVIIHVATAK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcagggatcagaatcaccgaggtggactggcagtggctgagaaatggtgctgcccac
cacacccaggagtaccccagccctgagttggtggttcgcagaggtcagatgttcaccttg
gtactggaactaaactgcccactggacagcaaggagaccctcatcttcacggtggagaca
ggaccccaggcttctgaggctctccacaccaaagctgtgttccagatagcggagctggag
gtgggagattcctggatggcagtgaaggaggctcagacagagaacacggtgactgtcagc
ctcaccagccctcccaatgctgtcattggccgctacctgctgagtgccaggatttcctct
cgccgcaaacacagtaaccggaagctgggagagtttgttctccttttcaacccatggtgc
ccagaggacgacgtgtttctggcctccgaggaggagagacaggagtacgtgctcaatgac
aacgggatcatcttccgaggcgtggagaagcacatccgagcccaaggctggaacttcggg
cagtttgaggaggacatcctgaacatttgcctctccatcctggaccgaagccctagtcac
caagatgacccagccattgatgtgtcctgccgccacgaccccgtctatgtcaccaggatc
atcagtgccatggtgaacagcaacaacgaccggggcgtggttcaaggccagtggcagggc
aagtacggcggcggcaccagcccactgcactggcgcggcagcgtggccattctgcacaag
tggttcaagggcaggttcaagccagtcaaatacggccagtgctgggttttcgctggagtc
atgtgcacagtccttaggtgcttggggatcgccacacgggttgtgtccaactttaactcg
gcccatgacacagacaggaacctgagtgtggacaaatacgtggactcctttgggcggacc
ctggaggacctgacagaagacagcatgtggaatttccatgtctggaatgagagctggttt
gcccggcaggacctgggcccttcttacaacggctggcaggttctggatgccaccccccag
gaggagagcgaaggcatattccggtgcggcccggcctcggtcaccgccatccgtgaaggc
gacgtgcacctggcccacgatggcccctttgtgtttgcggaggtcaacgcagactacatc
acctggctctggaatgaggatgagagccgggagcgtgtgtactcagacacaaagaagatc
gggaggtgcattagcaccaaggcggtgggcagcgactcccgtgtggacatcacaggcctc
tacaagtatccggaagggtcccggaaggagagacaggtgtacagaaaggccgtgaggaag
ctgttcagtgtggaagcctctgggaggagggccagggtccggaggattggcggccgtggt
ctctggcgtgatgacctcctggaacccgctaccaagcccagcatcaccggcaagttcaag
gtactggagccgcccgtgctgggacatgacctgaagctggcgctgtgcttgaccaacctc
acctccagggcccagcggatccgagtcaacctgagcggtgccaccatcctctacactcgc
aggccagtggcagagatcctgcacgaatcccgcacagtgcggctagggccggaagaagag
aaaaaaatgccaatcaaaatatcttactcccaatataagggagacctgacagaggacaag
aagatcctgttggctgccatgtgcattgtcatcaaaggagagaagctcctggtagagaag
gacatcactctggaggacttcattgccatcaaggtgctgggcccagccatggtgggggtg
gcagttacggtggaagtgatggtggtcaacccactcttggagagagtggagaactgtatg
ctgatggtagagggcagtggtcttctccaaggacagctcagcatcaaggttcccagccta
gagccccaacagagtgccttggtccagttcaacatcaccccttctaagagtggcccaagg
cagctgcaggtggaccttgtcagcccccacttctcggacatcaagggctttgtgatcatc
cacgtggccacagccaagtga

DBGET integrated database retrieval system