KEGG   Hipposideros armiger (great roundleaf bat): 109384577
Entry
109384577         CDS       T04661                                 

Gene name
PPARG
Definition
(RefSeq) peroxisome proliferator activated receptor gamma
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai03320  PPAR signaling pathway
hai04152  AMPK signaling pathway
hai04211  Longevity regulating pathway
hai04380  Osteoclast differentiation
hai04714  Thermogenesis
hai05016  Huntington disease
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    109384577 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    109384577 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109384577 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    109384577 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    109384577 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109384577 (PPARG)
   05202 Transcriptional misregulation in cancer
    109384577 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    109384577 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109384577 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109384577 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hai03310]
    109384577 (PPARG)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    109384577 (PPARG)
Nuclear receptors [BR:hai03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   109384577 (PPARG)
SSDB
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A TPR_11
Other DBs
NCBI-GeneID: 109384577
NCBI-ProteinID: XP_019501602
LinkDB
Position
Un
AA seq 505 aa
MGETLGDSLIDPESDSFADTLSASTSQEITMVDTEMPFWPTNFGISSVDLSVMDDHSHAF
DIKPFTTVDFSSISTPHYEDIPFARADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKA
QLYSKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgggtgaaactctgggagattctcttattgacccagaaagtgattccttcgccgataca
ctgtctgcaagcacttcacaagaaattaccatggttgacacagagatgccgttttggccc
accaactttggaatcagctccgtggatctttccgtaatggatgaccactcccatgccttt
gacatcaagcccttcaccaccgtcgacttctccagcatttctactccacactatgaagac
attccattcgcaagagctgacccaatggttgctgattacaagtatgacctgaagctgcaa
gagtaccaaagtgcaatcaaagtggagccagcatccccaccttattattctgaaaaggct
cagctgtacagtaagcctcatgaagagccttccaactccctcatggcaattgaatgccgt
gtctgcggagataaagcttctgggttccactacggagttcatgcttgcgaaggatgcaag
ggtttcttccggagaacaatcagattgaagcttatttatgataggtgtgatcttaactgt
cggatccacaaaaaaagtagaaataaatgtcagtactgccggtttcagaaatgccttgcg
gtggggatgtctcacaatgccatcaggtttgggcggatgccacaggctgagaaggagaag
ctgttggcagagatctccagtgatatcgaccagctgaacccagagtctgctgatctccgg
gccctggcaaaacatttgtatgactcatacataaagtccttcccgctgaccaaagcaaag
gcgagggccatcttgacaggaaagacaacagataaatcaccatttgttatctatgacatg
aattccttaatgatgggagaagataaaatcaagttcaaacacatcacccccttgcaggag
cagagcaaagaggtggccatccgcatttttcaggggtgtcaatttcgttcagtggaagct
gtgcaagagatcacagaatatgccaaaagtattcctggttttgtaaaccttgacttgaat
gaccaagtaactctcctaaaatatggcgtccatgagatcatttacacaatgctggcctcc
ttgatgaataaggatggggttctcatatcagagggccaaggattcatgacaagggagttt
ctaaagagcctgagaaagccctttggtgactttatggaacccaagtttgagtttgctgtg
aagttcaatgcactggaattagatgacagtgacttggcaatatttatagccgtcattatt
ctcagcggagaccgcccaggtttgctgaatgtgaagcccattgaggacatacaagacaac
ttgctgcaagctttggagctccagctcaagctgaaccacccagagtcctctcagctcttt
gccaagctgctccagaaaatgacagacctcagacagattgtaacagaacacgtgcaacta
ttgcaagtgataaagaaaacagagacagacatgagtcttcacccactcctacaggaaata
tacaaggacttgtattag

DBGET integrated database retrieval system