KEGG   Hipposideros armiger (great roundleaf bat): 109384704
Entry
109384704         CDS       T04661                                 

Gene name
RSAD2
Definition
(RefSeq) radical S-adenosyl methionine domain containing 2
  KO
K15045  radical S-adenosyl methionine domain-containing protein 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai05160  Hepatitis C
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109384704 (RSAD2)
   05160 Hepatitis C
    109384704 (RSAD2)
SSDB
Motif
Pfam: Radical_SAM Fer4_14 Fer4_12
Other DBs
NCBI-GeneID: 109384704
NCBI-ProteinID: XP_019501821
LinkDB
Position
Un
AA seq 362 aa
MWLLTPLGFAGKLLGAFRKQLSSLWGSLVPLLLWLRSAFWLAGTEGGQRQQGRKELKGTR
QEEEASDDQPLTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLMLREAGMEK
INFSGGEPFLHERGDYLGKLVKFCKEDLGLPSVSIVSNGSLIRERWFKSYGEYLDILAIS
CDSFEEQVNVLIGRGQGNINHVENLQKLRKWCRDYKVAFKINSVINRFNVEEDMREHIKA
LNPVRWKVFQCLLLEGENTGEDALREAERFLISDEEFEDFLERHREVSCLVPESNQKMKD
SYLILDEYMRFLNCTKGRKDPSKSILDVGVEEAIKFSGFDENMFLKRGGKYTWSKADLKL
DW
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtggctactcacgcctctcggctttgctggaaagctgctgggcgccttcaggaagcag
ctgagctctctttggggcagcctggtccccctgctcctctggctcaggtcagcattctgg
ctggcagggaccgaagggggacagaggcagcagggcaggaaagaactcaagggcacccga
caggaagaggaggccagcgatgatcagcccctcactcccaccagtgtcaactaccacttc
acccgccagtgcaactacaagtgtggcttctgcttccacacagccaagacgtccttcgtg
ctgcccctcgaggaggcgaaaaggggactgctgatgctcagggaagccggtatggagaag
ataaacttttccggcggagagcctttccttcacgagcggggtgactacctgggcaagctg
gtgaagttttgcaaagaggaccttggtctgcccagcgtgagcatcgtcagcaacggcagc
ctgatcagggagcgctggttcaagagttacggtgaatatctggacattctcgccatctcc
tgcgacagctttgaagagcaagtcaatgtccttatcggccgtggtcaaggaaacatcaac
catgtggaaaatcttcaaaaactgaggaagtggtgtcgagattataaagtggccttcaag
ataaattcagtcattaatcgatttaatgtggaagaggatatgagggaacatattaaagca
ctgaaccctgtccgctggaaggtcttccagtgcctcctactcgagggcgagaatactgga
gaagacgccttgcgggaagcagaacggttcctcattagcgacgaggaatttgaggacttc
ttagagcgccacagagaggtgtcctgtttggtgccggagtcgaaccagaagatgaaagac
tcctaccttattctggacgaatacatgcgcttcctgaactgtacaaaggggcggaaggat
ccttccaagtccatcctggatgttggagtcgaagaagctataaaattcagtggctttgat
gaaaacatgtttctgaagcggggaggaaagtatacgtggagcaaggcagacctcaagctg
gactggtaa

DBGET integrated database retrieval system