KEGG   Hipposideros armiger (great roundleaf bat): 109384758Help
Entry
109384758         CDS       T04661                                 

Gene name
FYN
Definition
(RefSeq) FYN proto-oncogene, Src family tyrosine kinase
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04360  Axon guidance
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04520  Adherens junction
hai04611  Platelet activation
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04725  Cholinergic synapse
hai05020  Prion diseases
hai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    109384758 (FYN)
   04071 Sphingolipid signaling pathway
    109384758 (FYN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109384758 (FYN)
   04520 Adherens junction
    109384758 (FYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109384758 (FYN)
   04650 Natural killer cell mediated cytotoxicity
    109384758 (FYN)
   04660 T cell receptor signaling pathway
    109384758 (FYN)
   04664 Fc epsilon RI signaling pathway
    109384758 (FYN)
  09156 Nervous system
   04725 Cholinergic synapse
    109384758 (FYN)
  09158 Development and regeneration
   04360 Axon guidance
    109384758 (FYN)
   04380 Osteoclast differentiation
    109384758 (FYN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion diseases
    109384758 (FYN)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109384758 (FYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109384758 (FYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109384758 (FYN)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     109384758 (FYN)
Protein kinases [BR:hai01001]
 Non-receptor tyrosine kinases
  SRC family
   109384758 (FYN)
Membrane trafficking [BR:hai04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    109384758 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    109384758 (FYN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_3 SH3_10 zf-RING_14
Motif
Other DBs
NCBI-GeneID: 109384758
NCBI-ProteinID: XP_019501899
LinkDB All DBs
Position
Un
AA seq 537 aa AA seqDB search
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFQKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLTCKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggacaaagaagctacaaaactgacagaggagagggatggc
agcctgaaccagagctccgggtaccgctatggcacagaccccactcctcagcactacccc
agcttcggtgtgacctccatcccaaactacaacaacttccacgcagccggaggccaagga
ctcaccgtctttgggggtgtgaactcttcgtctcatactgggaccttgcgtacgagagga
ggaacaggagtgaccctgtttgtggccctttatgattatgaagcacggacggaagatgac
ctgagttttcaaaaaggagaaaaatttcaaatattgaacagctcggaaggagattggtgg
gaagcccgctccttgacaaccggagagacgggctacattcccagcaattacgtggctcca
gtggactccattcaggcggaagagtggtactttggaaaacttggccgaaaagatgctgag
cgacagcttttgtcctttggaaacccaagaggtacctttcttatccgtgagagtgaaacc
accaaaggtgcctattcactttctatccgtgattgggatgatatgaaaggagaccatgtc
aaacattataaaattcgtaaacttgacaatggtggatactatattaccacccgagcccag
tttgaaacacttcagcaacttgtgcaacattactcagagagagccgcaggtctctgctgc
cgcctagtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaacacaaaagtagccataaagact
cttaaaccgggcacgatgtcccctgaatcattccttgaggaagcacagatcatgaagaaa
ctgaaacatgacaagttggtccagctctacgcggtggtgtctgaggaaccaatctacatc
gtcaccgagtatatgaataaaggaagtttactggatttcttaaaagatggagaaggaaga
gctctgaaattaccaaacctggtggacatggcagcacaggttgccgcaggaatggcttac
atcgagcgcatgaattatatccacagagacctgcgatctgcaaacattctagtggggaat
gggctgacgtgcaagattgccgactttggactggccagattgatcgaagacaacgagtac
accgccagacaaggtgcaaagttccccattaagtggacagcccccgaagcagccctgtac
gggaggtttacaatcaagtctgacgtgtggtcttttggaatcttactcacagagctggtc
accaaaggaagagtgccgtacccaggcatgaacaaccgggaggtgctggagcaggtggag
cgtggctacaggatgccctgtccgcaggactgccccatctctctacacgagctcatgatc
cactgctggaaaaaggacccagaggaacggcccactttcgagtacttgcagggcttcctg
gaagactacttcacagccaccgagccccagtatcagcctggtgaaaacctgtga

DBGET integrated database retrieval system