KEGG   Hipposideros armiger (great roundleaf bat): 109384760Help
Entry
109384760         CDS       T04661                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04110  Cell cycle
hai04213  Longevity regulating pathway - multiple species
hai04330  Notch signaling pathway
hai04919  Thyroid hormone signaling pathway
hai05016  Huntington disease
hai05034  Alcoholism
hai05165  Human papillomavirus infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05202  Transcriptional misregulation in cancer
hai05203  Viral carcinogenesis
hai05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    109384760 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109384760 (HDAC2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109384760 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109384760 (HDAC2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    109384760 (HDAC2)
   05202 Transcriptional misregulation in cancers
    109384760 (HDAC2)
   05203 Viral carcinogenesis
    109384760 (HDAC2)
   05220 Chronic myeloid leukemia
    109384760 (HDAC2)
  09163 Neurodegenerative diseases
   05016 Huntington disease
    109384760 (HDAC2)
  09164 Substance dependence
   05034 Alcoholism
    109384760 (HDAC2)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    109384760 (HDAC2)
   05165 Human papillomavirus infection
    109384760 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109384760 (HDAC2)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109384760 (HDAC2)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     109384760 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     109384760 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109384760 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    109384760 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 109384760
NCBI-ProteinID: XP_019501907
LinkDB All DBs
Position
Un
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKADVKEEDKSKDNSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcagggaggcggcaagaagaaagtctgctactactacgatggtgatatt
ggaaattattattatggacagggccatcccatgaaacctcatagaattcgcatgacccat
aacctgctgctaaattatggcttatatagaaaaatggaaatatacaggccccataaagcc
accgctgaagaaatgacaaaataccacagtgatgagtacatcaaatttctacgttcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaagat
tgtccagtgtttgatggactctttgagttttgtcagctgtcaactggtggctcagttgct
ggagctgtgaagttaaaccgacaacagactgatatggctgttaattgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttatgttaatgatattgtgcttgcc
atccttgaattactaaagtatcatcagagagtcttatatattgatattgatatccatcac
ggtgatggtgttgaagaagctttttataccacagatcgtgtaatgactgtatcattccat
aaatatggggaatacttccctggaacaggagacttgagggatattggtgcaggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgagtcatatgggcag
atatttaagcctattatctcaaaagtgatggagatgtatcaacctagtgctgtcgtgtta
cagtgtggtgcagactcactatctggtgatagacttggttgcttcaatctgacagtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaactttcaatttaccattactgatgcttgga
ggaggtggatacacaatccgtaatgttgctcggtgttggacatatgagactgcagttgcc
cttgattgtgaaattcccaatgaattgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaatcagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttacgcatgttacctcacgcacctggcgtc
caaatgcaagctattccagaagatgctgttcatgaagacagtggagatgaagacggagaa
gatccggacaaaagaatttctattcgagcatcagacaaacggatagcttgtgatgaagaa
ttttcagattcagaggatgaaggagaaggaggtcgtagaaatgtagctgatcataagaaa
ggagcaaagaaagctagaattgaggaagacaaaaaggaaacagaggacaaaaaagcagat
gtgaaggaagaagacaaatccaaggataatagtggtgaaaaaacagataccaaaggagcc
aaatcagaacagctcagcaacccttga

DBGET integrated database retrieval system