KEGG   Hipposideros armiger (great roundleaf bat): 109384938
Entry
109384938         CDS       T04661                                 

Gene name
JAK1
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai04151  PI3K-Akt signaling pathway
hai04217  Necroptosis
hai04380  Osteoclast differentiation
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04621  NOD-like receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai05140  Leishmaniasis
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05212  Pancreatic cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109384938 (JAK1)
   04151 PI3K-Akt signaling pathway
    109384938 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109384938 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109384938 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109384938 (JAK1)
   04658 Th1 and Th2 cell differentiation
    109384938 (JAK1)
   04659 Th17 cell differentiation
    109384938 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109384938 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109384938 (JAK1)
   05203 Viral carcinogenesis
    109384938 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109384938 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109384938 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109384938 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109384938 (JAK1)
   05162 Measles
    109384938 (JAK1)
   05164 Influenza A
    109384938 (JAK1)
   05161 Hepatitis B
    109384938 (JAK1)
   05160 Hepatitis C
    109384938 (JAK1)
   05168 Herpes simplex virus 1 infection
    109384938 (JAK1)
   05163 Human cytomegalovirus infection
    109384938 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109384938 (JAK1)
   05169 Epstein-Barr virus infection
    109384938 (JAK1)
   05165 Human papillomavirus infection
    109384938 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109384938 (JAK1)
   05140 Leishmaniasis
    109384938 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109384938 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109384938 (JAK1)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     109384938 (JAK1)
Protein kinases [BR:hai01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   109384938 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2 DUF4079
Other DBs
NCBI-GeneID: 109384938
NCBI-ProteinID: XP_019502243
LinkDB
Position
Un
AA seq 1153 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLPDREPLRLSGGEYTAEEL
CIKAAQACCISPLCHNLFALYDENTKLWYAPNHTITVDDKTSARLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMIKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
RFHPNDSGIVLYYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKHKKDEDKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKHEVLGGQKQFKNFQIEVQKGRYSLHGSDHSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIMQGEHLGRGTRTHIYSGT
LVDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDNECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCEELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPSNCPEEVYQLMRKCWEFQPSNRTT
FQNLIEGFEALLK
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgctatggctttctgtgctaaaatgcgg
agctccaagaagaccgaggtgaacctggaggcccctgagccaggggtggaagtgctcttc
tacctgccggatagggaacccctccggctgagcggtggggagtacactgcggaggagctt
tgcatcaaggctgcgcaggcgtgctgtatctctcctctgtgtcacaacctctttgccctt
tatgatgagaacaccaagctctggtatgctccgaatcacaccatcaccgtggacgacaag
acatcggcccggctccactaccggatgaggttctatttcaccaactggcacgggaccaat
gataacgagcagtctgtgtggcgacattctcccaagaagcagaaaaacggttacgagaaa
aaaaaagttccagatgcaacccctctccttgacgccagctccctggagtatctgtttgct
cagggacagtatgacttggtcaaatgcctggctcctattcgagaccccaagactgagcag
gacgggcacgacatcgagaacgagtgcctggggatggccgtcctcgccatctcccactat
gccatgatcaagaagatgcagttgccagaactccccaaggacatcagctacaaacgatat
attccagaaacattaaataagtccatcaggcagaggaaccttctcaccaggatgcggata
aataacgtcttcaaggatttcctaaaggaatttaacaacaagaccatttgtgacagcagc
gtgtctacccatgacctgaaggtgaaatacctggctacgctggagactctgacaaaacat
tatggtgctgaaatatttgagacctccatgttactgatttcatcagaaaatgagatgaat
cgatttcatccaaacgatagtggaattgttctctactatgaagtgatggtgactggaaat
cttggaatccagtggagacagaaaccaaatgttgttcctgttgaaaaggagaaaaataaa
ctgaaacggaaaaaactggaaaataaacacaagaaggatgaggacaaaaacaaaatccgg
gaagagtggaacaatttttcttacttccccgaaatcactcacattgtgataaaggagtcc
gttgtcagcattaataagcaggacaacaaaaaaatggaactgaagctgtcttcccacgag
gaggccctgtcctttgtgtccctggtagatggctactttcggctcacagcagacgcccat
cattacctctgcaccgatgtggctcccccattgatcgtccacaacatacagaatggctgt
catggtccaatctgcacagaatacgccatcaataaactgcggcaagaaggaagtgaggag
ggcatgtacgtgctgcggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgctttgaaaagcatgaggtgctgggtggccagaaacagttcaagaactttcagatcgag
gtgcagaagggtcgctacagtctgcacggctcagaccacagcttccccagcctgggggac
ctcatgagccatctcaagaagcagatcctgcgcacggacaacatcagctttgtgctgaag
cgctgctgccagcccaagccccgagaaatctccaatcttctggtggctactaagaaagcc
caggagtggcagcccgtctaccccatgagtcagctgagtttcgatcggattctcaagaaa
gacattatgcagggcgagcacctcgggagaggcacgcggacacacatctactctgggacc
ctggtggattacaaggacgacgaagggacttccgaagagaaaagaatcaaagtgatcctc
aaagtcttagaccccagtcacagggacatttctctggccttcttcgaggcagccagcatg
atgaggcaggtctcccacaagcacatcgtttacctctatggcgtctgtgtccgggacgtg
gagaatatcatggtggaagagtttgtggaggggggacccttggatctcttcatgcaccgg
aagagcgatgtcctcaccacaccatggaagttcaaagttgcaaaacagctggccagcgcc
ctgagttacttggaggataaagacctggtccatggaaacgtgtgcactaaaaacctcctc
ctggcccgcgagggcattgacaacgagtgcggcccattcattaagctcagtgaccccggc
atccccatcactgtgctgtccagacaagaatgcatagaacgaatcccatggattgctccc
gagtgtgtggaagactccaagaacctgagtgtggccgctgacaaatggagctttggaact
acactctgggaaatctgctacaatggcgagatccccctgaaagacaagacgctgattgag
aaagaaagattctacgaaagccggtgccggccagtgacaccatcttgtgaggagctggct
gaccttatgactcgctgcatgaactatgaccccaatcagagaccctttttccgagctatc
atgagagacatcaataagctggaagagcagaatccagacattgtttcagaaaagaagcca
gcaaccgaagtggatcccacacatttcgaaaagcggttcttaaagaggatccgtgacttg
ggagagggccactttgggaaagtggagctctgcaggtatgaccctgaaggggacaacaca
ggggagcaggtagccgtcaaatccctgaagcctgagagtggcggcaaccacatcgctgat
ctgaagaaggaaatcgaaatcttaaggaacctctatcacgagaacatcgtgaagtacaaa
ggcatctgcacagaagatgggggaaatggtattaagctcatcatggaatttctaccttca
ggaagccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacagcagttg
aaatatgccgttcagatttgtaaggggatggactatttgggttcacggcaatacgttcac
cgagacttagcagcaagaaatgtccttgtcgagagtgaacaccaagtgaagattggagac
ttcggtttaaccaaagcaattgaaaccgataaggagtactacacagtcaaggatgatcgg
gacagccctgtgttttggtatgctccagaatgtttaattcagtgtaaattttatatcgcc
tctgacgtctggtctttcggcgtgactctgcacgagctgctcacttactgtgattcggac
tccagccccatggccttgttcctgaaaatgataggccctactcacggccagatgacagtc
acaagacttgtgaatacattaaaagaaggaaaacgtttgccttgtccatctaactgtcca
gaagaggtttatcagcttatgagaaaatgctgggaattccaaccatctaatcggacaact
tttcagaaccttattgaaggatttgaagcacttttaaaataa

KEGG   Hipposideros armiger (great roundleaf bat): 109391605
Entry
109391605         CDS       T04661                                 

Gene name
TYK2
Definition
(RefSeq) tyrosine kinase 2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04217  Necroptosis
hai04380  Osteoclast differentiation
hai04621  NOD-like receptor signaling pathway
hai04630  JAK-STAT signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai05145  Toxoplasmosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05168  Herpes simplex virus 1 infection
hai05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109391605 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109391605 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109391605 (TYK2)
   04658 Th1 and Th2 cell differentiation
    109391605 (TYK2)
   04659 Th17 cell differentiation
    109391605 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109391605 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    109391605 (TYK2)
   05164 Influenza A
    109391605 (TYK2)
   05161 Hepatitis B
    109391605 (TYK2)
   05160 Hepatitis C
    109391605 (TYK2)
   05168 Herpes simplex virus 1 infection
    109391605 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109391605 (TYK2)
   05169 Epstein-Barr virus infection
    109391605 (TYK2)
   05165 Human papillomavirus infection
    109391605 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109391605 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109391605 (TYK2)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     109391605 (TYK2)
Protein kinases [BR:hai01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   109391605 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Jak1_Phl Pkinase FERM_F2 FERM_F1
Other DBs
NCBI-GeneID: 109391605
NCBI-ProteinID: XP_019514811
LinkDB
Position
Un
AA seq 1241 aa
MGGAVSAAIRRRLRWAAGLGPGFELLSPGWVTLVESVESLTAPPWRYRRPQEAWALSLAF
EKSWSWAGGLYQAKPAVKSMPLCHWRATARCSKPDGDGAQLMATRGVLKVLLHWAGPDGG
EPWVTFSEATLTAEEVCIHIAQKVGITPSCLNLFALFDAQAQVWLSPNHILEVSRDASLT
LHFRMRFYFRNWHGTNPQEPAVYRCGPPGAKASSDQAEQGVQLLDPASFEYLFEQGKHEF
VNDVASLWELSSEEEIHHFKNESLGMAFLHLCHLSLRLSVPLEKVTKKISFKDCIPRSFR
EQIQQHNAFTRLRLWIIFHRFLRAFQPGHLSQQVIMVKYLATLERLAPRFGTERVPVCHL
ELLAQAEGEPCYIRDSRQAPLNPGPESAAGPPTHEVLVTGTGGIQWRPVQAEGPSGGDGG
RSRNPHARSLGKKAKAQELGNQPMDRLREVPWAYFCDFQDITHVVLRECHVSIHCQDNKC
LELTLPSRAKALSLVSLVDGYFRLTADSSHYLCHEVAPPRLVMSIQDGVHGPLLEPFVLA
KLRPEDGLYLIHWSTSHFNRLILTVAQRDQEHGTQGLRLRKFPIELHTGAFTLESWDRSF
PSVRELRAALQGCLLRAGDDCFSLRHCCLPQPGEISNLIIMRGPQASTRPLNLSQLSFHR
VCQDDITQLSHLGQGTRTNVYEGRLRIGGRGPEEDKADGGDTPMPSEGHGQELRVVLKVL
DSSHHDIALAFYETASLMSQVSHVHLAFVHGVCVHGSKNIMVTEYVEHGPLDMWLRRERG
CVPVAWKVAVAQQLASALSYLEDKRLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGL
GALSREERVERIPWMAPECLSGGANSLTTAADKWGFGASLLEICFNGEAPLQCRSPSEKE
HFYHKQHQLPEPSCPELAMLTSQCLTYEPAQRPSFRTILRDLTRLQPQNLVDVLAVNPDL
QAADPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQLRTGW
RREIDILRTLYHEHIVQYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQLLLFA
QQICEVGRSAPARRTCPSSLAWPVCPIPLLGRPRPWANFPKYAPECLKECKFYYASDVWS
FGVTMYELLTYCDSSQSPPSKFLELIGLTQGQMAVLRLTELLERGERLPRPEKCPCEIYL
LMKNCWKAEASIRPTFQNLIPILKTLHEKYQGQAPSVFSVC
NT seq 3726 nt   +upstreamnt  +downstreamnt
atgggaggtgctgtctcggcggcgatcagacggaggctgcggtgggcggcggggctgggt
cccgggttcgagttactgtccccaggatgggtaacattggtggaatcagtggaatcactg
acagcgcctccctggagataccggagacctcaggaggcctgggccctgagcctggctttt
gaaaagtcctggagctgggctggaggcctgtatcaagccaagccagctgtcaagagcatg
cctctatgccactggagggccactgccaggtgcagcaagcctgatggcgatggagctcag
ctcatggccaccagaggagtcctgaaggtgctactgcactgggctggccctgacggcgga
gagccctgggtcaccttcagcgaggccacactgactgcggaggaggtctgcattcatatc
gcacagaaagtcggcatcactccatcctgcctcaatctctttgccctcttcgatgcccag
gcccaggtctggctgtccccaaaccacatcttggaggtctccagagacgcaagcctgacg
ctgcatttccgcatgaggttttatttccggaactggcacggcacgaatcctcaggagcca
gctgtgtaccgctgtgggcccccaggggccaaggcttcatcggatcaggcagagcaaggg
gtgcaactcctggacccagcctcctttgagtacctctttgagcagggcaagcatgagttt
gtgaatgatgtagcatcgctgtgggagctgtcaagtgaggaggagatccaccactttaag
aatgagagcctgggcatggcctttctgcacctctgccacctctctctccgcctcagtgtt
cccctggagaaggtgaccaagaagatcagcttcaaggactgcatcccacgctccttccgg
gagcaaatccagcaacacaacgccttcacacggctgcgcctgtggatcatcttccacagg
ttcctgcgggccttccagccaggccacctctcccagcaggtcatcatggtcaagtacctg
gccacacttgagcggctggcgccccgcttcggcacagagcgtgtgcctgtatgccaccta
gagctgctggcccaggctgagggggagccctgctacatccgggacagcaggcaggcccct
ttgaaccctgggcccgagtctgctgcaggacccccgactcacgaggtgctggtgaccggc
actggtggcatccagtggcggccagtacaggcagagggtcccagtggtggtgacggtggc
aggagcaggaatccccatgctcgctcacttgggaagaaagccaaggcccaagagttgggc
aaccaaccaatggacaggctgcgcgaggtgccgtgggcctacttctgtgacttccaggac
attacccatgtggtgctgagagaatgccatgtcagcatccactgtcaagacaacaagtgc
ctggagctgactctgccttcccgggccaaggccctgtccttggtgtcactggtggatggc
tatttccgcctgacagccgactcgagccactacctatgccacgaagtggctcctccacgg
ctagtgatgagtatccaggacggtgttcacggacctctgctggagccatttgtgctggct
aagctgcggccggaggatggcctctatctcatccactggagcaccagccacttcaaccgc
ctcatcctcacggtggcccagagggaccaggaacatggcacgcagggcttgcgcctgcgg
aaattccccattgagctgcatacgggggccttcacactggagagctgggaccggtccttc
cccagtgtgcgggagcttcgggcagccctgcagggctgcttactacgggccggagatgac
tgcttctccttgcgccactgttgcctgccgcagccaggagagatctccaacctcatcatc
atgcgggggcctcaggccagcaccaggcctctcaacctcagccagctcagcttccaccgg
gtctgccaggatgacatcacccagctgtcccacttgggccagggcacgaggaccaacgtg
tatgagggccgcttgcgaatagggggcagaggccctgaggaggacaaggcagatggtggg
gacacccccatgcccagtgagggccatgggcaggagctacgagtggtgctgaaggtgcta
gactccagtcaccatgacatcgccctggccttctatgagacagccagcctgatgagccag
gtgtcccacgtgcacctggccttcgtccatggcgtctgtgtgcacggctccaagaacatc
atggtgacagagtacgtggagcatggacctctagacatgtggctgcggcgggagaggggc
tgcgtgcctgtggcctggaaggtggcagtagcccagcagctggccagtgcccttagctac
ctggaagacaagagactggttcatggtaacgtgtgtggccggaacatcctgctggcacgt
ctggggttggcagagggtaccagcccattcatcaagctgagtgaccccggcgtgggcctg
ggcgccctctccagggaggagcgggtagagcggatcccctggatggcccctgagtgcctc
tccggcggagccaacagcctaaccaccgctgctgacaagtggggctttggtgccagcctc
ctggagatctgcttcaacggggaggctcctctgcagtgtcgcagcccctctgagaaagag
cacttctaccacaagcagcaccagctgcctgaaccctcgtgccctgagctggccatgctt
accagccagtgcctgacctatgagcctgcccagcggccatctttccgcaccatcctgcgt
gacctcactcggctgcagccccaaaatcttgttgatgtcttggctgtgaacccagacttg
caggcggcagaccccactgttttccacaagcgctatttgaaaaagattcgggatctgggc
gagggtcacttcggcaaggtcagcctatactgttacgacccgaccaacgacggcactggc
gagatggtggcagtgaaggccctcaaagcagactgcggccctcagctccgcactggctgg
aggcgggagatcgacatcctgcgtacgctctaccatgagcacattgtccagtacaaaggc
tgctgcgaggaccaaggcgaaaaatcagtacagctcgtcatggagtacgtacccctgggc
agcctacgagactacctgccccggcacagcgttgggctggcccagctgctgctgttcgcc
cagcagatctgcgaggtgggccggtcagcccctgctcgcagaacctgcccctcgtctttg
gcttggcctgtgtgtcccatccctttgcttggtcgaccccgcccctgggctaactttcca
aagtatgccccagagtgcctgaaggagtgtaagttctactatgcatctgacgtctggtcc
tttggggttaccatgtatgaactgcttacctattgtgactccagccaaagccccccctcg
aaattcctcgagctcataggcctcacccaggggcagatggcagtactgaggctcactgag
ctgctggaacgaggggagaggctgcctcggccagagaaatgtccctgtgagatctatctc
ctcatgaagaactgctggaaggcagaggcctcaatccgcccaactttccagaacctcata
cccatcctgaaaacattgcacgagaaataccagggccaggccccctctgtgttcagtgtc
tgctga

DBGET integrated database retrieval system