KEGG   Hipposideros armiger (great roundleaf bat): 109384978Help
Entry
109384978         CDS       T04661                                 

Gene name
NCF1
Definition
(RefSeq) neutrophil cytosolic factor 1
  KO
K08011  neutrophil cytosolic factor 1
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04062  Chemokine signaling pathway
hai04145  Phagosome
hai04380  Osteoclast differentiation
hai04666  Fc gamma R-mediated phagocytosis
hai04670  Leukocyte transendothelial migration
hai05140  Leishmaniasis
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109384978 (NCF1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    109384978 (NCF1)
   04670 Leukocyte transendothelial migration
    109384978 (NCF1)
   04062 Chemokine signaling pathway
    109384978 (NCF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109384978 (NCF1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109384978 (NCF1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109384978 (NCF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109384978 (NCF1)
Membrane trafficking [BR:hai04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    109384978 (NCF1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    109384978 (NCF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 NECFESHC SH3_9 p47_phox_C SH3_2 PX hSH3 SH3_3
Motif
Other DBs
NCBI-GeneID: 109384978
NCBI-ProteinID: XP_019502361
LinkDB All DBs
Position
Un
AA seq 392 aa AA seqDB search
MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKALKEMFPI
EAGDISPESRIIPHLPAPRWFDGQRAAESRQGTLTEYCNALMGLPVKISRCPHVLDFFKV
RPDDLKLPTDSQVKKPETYLMPKDGKTNAADITGPIILQTYRAIADYEKSSGSEMALAMG
DVVDVVEKGESGWWFCQMKTKRGWVPASYLEPLDSPDEVEDPEPNYAGEPYVTIKTYTAV
LEDEVSLQEGETIDVIHKLLDGWWVIRKEDVTGYFPSMYLQKAGQDIAQAQRQIKRRGAP
PRRSSIRNAHSIHQRSRKRLSQDTYRRNSVRFLQQRRRLVRPEPQSAGSPLTEEQPQTER
PKPQPAVPPRPSADLILNRCSESTKRKLASAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggggacacctttatccgtcacatcgccctcctgggctttgagaagcgcttcgtcccc
agccagcactacgtgtacatgttcctggtgaagtggcaggacctgtctgagaaggtggtc
taccggcggttcaccgagatctatgagttccacaaagccttaaaggagatgtttcctatc
gaggcaggggacatcagcccagagagcaggatcatcccacacctgccagcgccgcggtgg
tttgacgggcagcgggcagcagaaagccgccagggcacgctcaccgagtactgcaatgcg
ctcatgggcctgccggtcaagatctcccgctgcccacacgtcctggacttcttcaaggtg
cgccccgacgacctcaagctccccacggacagccaggtgaaaaagccagagacatacctg
atgcctaaagatggcaagactaacgctgcggacatcacgggccccatcatcctgcagaca
taccgggccattgctgactacgagaagagctcgggctccgagatggctctggccatgggt
gacgtggtggacgtcgtggagaagggcgagagcggctggtggttctgccaaatgaagaca
aagcgtggttgggtcccagcgtcctacttggagcccctggacagtcctgacgaggtagag
gacccagagcccaactatgcaggtgagccctatgtcaccatcaaaacctacactgccgtg
ttggaggacgaggtgtccttgcaggagggtgaaaccattgacgtcattcataagctcctg
gacggctggtgggtcatcaggaaagaagacgtcacgggctacttcccgtccatgtacctg
cagaaggcagggcaggacatagcccaggcccaacgccagatcaagagacgaggggcaccg
ccccgcaggtcatccatccgcaacgcgcacagcatccaccagcggtcacggaaacgcctc
agccaggacacctatcggcgcaacagcgtccgctttttgcagcagcgtcgccgcctggtg
cggcccgagccgcagagtgcggggagcccgctgacagaggagcagccgcagactgagcgc
ccgaagccgcagcccgcagtccccccacggcccagcgctgacctcatcctgaaccgctgc
agcgagagcaccaagcggaagctggcgtcagctgtctga

DBGET integrated database retrieval system