KEGG   Hipposideros armiger (great roundleaf bat): 109385084
Entry
109385084         CDS       T04661                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00220  Arginine biosynthesis
hai00330  Arginine and proline metabolism
hai01100  Metabolic pathways
hai04020  Calcium signaling pathway
hai04066  HIF-1 signaling pathway
hai04146  Peroxisome
hai04371  Apelin signaling pathway
hai04926  Relaxin signaling pathway
hai05010  Alzheimer disease
hai05014  Amyotrophic lateral sclerosis
hai05022  Pathways of neurodegeneration - multiple diseases
hai05133  Pertussis
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05146  Amoebiasis
hai05152  Tuberculosis
hai05200  Pathways in cancer
hai05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    109385084 (NOS2)
   00330 Arginine and proline metabolism
    109385084 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109385084 (NOS2)
   04066 HIF-1 signaling pathway
    109385084 (NOS2)
   04020 Calcium signaling pathway
    109385084 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109385084 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    109385084 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109385084 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109385084 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109385084 (NOS2)
   05014 Amyotrophic lateral sclerosis
    109385084 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109385084 (NOS2)
   05152 Tuberculosis
    109385084 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109385084 (NOS2)
   05145 Toxoplasmosis
    109385084 (NOS2)
   05140 Leishmaniasis
    109385084 (NOS2)
   05142 Chagas disease
    109385084 (NOS2)
Enzymes [BR:hai01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     109385084 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 109385084
NCBI-ProteinID: XP_019502508
LinkDB
Position
Un
AA seq 1157 aa
MACPWKFLFKTRSYQYEPTKELDINNNVGKAIQALSSPVTQDDPKCHGLVKHQDESPQPF
TGTVKKPPEPLVKLDAPPSTCPRHVRIKNWGSGMTFQDTLHHKAKGDLACKSKCCLGAIM
NPKSLTRGPRDKPTPPDELLPQAIEFVNQYYNSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNNGNI
RSAITVFPQRSDGKHDFRVWNSQLIRYAGYQMPDGTIQGDPACVEFTQLCIDLGWKPKYG
RFDVMPLVLQADGRDPELFEIPPDLVLEVTMEHPKYEWFRELELKWYTLPAVSNMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNIMEEVGRRMGLETHKLASLWKDQAVIEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWVWLVPPISGSITSVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPQRREIRFRVLVKAVLFTSMLMRKTMALRVRTT
ILFATETGKSEMLAQDLRALFSCAFNPKVVCMDEYRLRSLEEEQLLLVVTSTFGNGDSPG
NGEKLKRSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLTPTGEGD
ELSGQEEAFRSWAMQTFKAACDTFNVRGKHCIQIPRLYTTKVTWDPHQYRLVQDSQPLDL
NKALSNMHAKNVFTMKLKSQQNLRSPKSSRTTLLVELSCEGSQDFSYLPGDHLGVFPSNQ
PASVQGILERLVDSPAPHQLMCLETLSENGSYWVREKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQLATEEAERQRLETLCQPSEYNKWKFTNSLTFLEVLEEFPSLRVSASFLLSQL
PILKPRYYSISSSRDRTPTEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDTVPCF
VRSASNFQLPEDPSHPCILVGPGTGIAPFRSFWQQRLHDAEHKGLRAGRMTLLFGCQRPD
EDHLYREEMLEMVQKGVLHEVHTAYSRLPGQPKVYVQDILRQQLADEVLCLLHKEQGHLY
VCGDVRMARDVAHTLKQLVAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYEGKKDG
AAGQASDPRAPTAPRRS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggaagtttctgttcaagaccagatcataccagtatgagccgacgaag
gaactggacatcaacaacaacgtggggaaagccatccaggctctctccagtccagtgaca
caggatgaccccaagtgtcatggcctcgtcaagcaccaggatgagtccccccagcccttc
acagggacagtcaagaagcctccggaacccttggtcaagttggatgctcccccatcaacc
tgtccacggcacgtgaggatcaaaaactggggcagtgggatgactttccaagacacactt
caccataaggccaaaggggatcttgcttgcaagtccaagtgttgcctgggagccatcatg
aaccccaaaagtttgaccagaggacctagggacaagcctactcccccagacgagcttcta
cctcaagctatcgaatttgtcaaccagtattacaactcctttaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccag
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaacgcccctcgctgc
attgggaggatccagtggtccaacctacaggtcttcgatgcccggagctgttccactgcc
caggaaatgttcgaacacatctgtagacacctgcgttatgccaccaacaatggaaacatc
aggtcggccatcaccgtgtttccccagcggagcgatgggaagcatgacttccgggtctgg
aactctcagcttatccggtatgctggctaccagatgcccgacggcacgatccaaggggat
cctgcctgtgtggagtttacccagctgtgcattgacctgggctggaagcccaagtacggc
cgcttcgatgtgatgccactggtcctgcaggctgatggccgtgaccctgagctctttgaa
atcccgcctgaccttgtgctcgaggtgaccatggaacatcccaagtacgagtggttccgg
gagctggagctgaagtggtataccctgcctgcagtgtccaacatgttgctcgaggtgggt
ggcctcgagttcccagggtgccccttcaacggctggtacatgggcacagagatcggggtc
cgagacttctgtgacgtccagcgctacaacatcatggaggaagtgggcagaagaatgggc
ctagaaacgcacaagttggcctcactctggaaagaccaggctgtcattgagatcaatgtt
gctgtgctccacagtttccagaagcaaaacgtgaccatcatggaccaccactctgctgca
gagtccttcatgaagtacatgcagaatgagtatcggtcccgagggggctgcccggccgac
tgggtttggctggttcccccaatttctggaagcatcacctccgtgttccaccaggagatg
ttaaactatgttctgtcccctttctactactaccaggtggaggcctggaaaacccacgtc
tggcaggatgagaagcggagaccccagagaagagagattcgattccgagtcttggtgaaa
gccgtgctcttcacctctatgctgatgcgcaagaccatggcactccgagttagaactaca
atcctctttgcgacagagacgggaaaatcagaaatgctggcccaggacctaagggctttg
ttcagctgtgccttcaaccccaaggtggtctgcatggacgagtacaggctgcgcagcctg
gaggaggagcagctgctgctggtggtgaccagcacctttgggaacggagactcccctggc
aacggagagaaactgaagagatccctgttcatgctgaaagagctcaccaacaagttcagg
tatgccgtgttcggccttggttccagcatgtaccctcagttctgcgcgtttgcccatgac
attgaccagaagttgtcccacctgggagcctctcagctcaccccaacaggggaaggggac
gagctcagtgggcaggaggaggccttccgcagctgggccatgcaaacgttcaaggcagcc
tgtgacacgttcaatgtccgaggcaaacactgcattcagatccccaggctctacaccacc
aaggtgacctgggacccgcaccaatacaggctcgtgcaagactcacagcctttggacctc
aacaaagctctcagcaatatgcacgccaagaatgtgttcaccatgaagctcaaatcgcag
cagaatctacggagtccgaaatccagccgcaccactctcctggtggaactctcttgtgag
ggcagccaagatttcagctacctgcccggagaccacctgggggttttcccaagtaaccag
ccagcctcggtccaaggcattttggagcggctggtggacagtcctgcaccccaccaactc
atgtgcctggagacccttagtgagaacggcagctactgggtcagggagaagcggctgcct
ccctgctcactcagccaggccctcacctacttcctggacattaccacccccccaacacag
ctgctgctccaaaagctggctcagctggccacagaagaggctgagagacagaggctggag
accttgtgccagccctcagaatacaacaagtggaagttcaccaacagcctcacattcctg
gaggtgctagaggagtttccctccctgcgggtgtctgccagcttcctgctctcccagctc
cctattctgaagccccgatactactccatcagctcctccagggaccgcacacccacggag
gtccacctcaccgtggctgtgctcacctaccgcacccgagatggccagggccccctgcac
catggcgtctgcagcacatggctcagcagcctgaagccccaggacacagtgccctgcttt
gtacgaagtgccagcaacttccagctccctgaggacccctcccatccttgcatcctcgtc
gggcctggcacaggcatcgcgcccttccgcagtttctggcagcagcggctccatgacgct
gagcacaaagggctccgggctggccgcatgaccttgctattcgggtgccagcgcccagac
gaggaccacctctatcgagaggaaatgttggagatggtccagaagggggtgctgcatgag
gtgcacacggcctattctcgcctgcctggccagcccaaggtctatgttcaagacatcctg
cggcagcagctggctgatgaggtgctctgcctgctccacaaggagcaaggccacctctat
gtctgtggggatgtgcgcatggcccgggatgtggcccacaccctgaagcagctggtggct
gccaagctgagcctgagtgaggagcaggtcgaggactatttcttccagcttaagagccag
aagcgctatcatgaagatatctttggtgctgtatttccctacgagggaaaaaaggatggg
gcagcagggcaggccagcgatcccagagcaccaacagcgcccaggagaagttga

DBGET integrated database retrieval system