KEGG   Hipposideros armiger (great roundleaf bat): 109385146
Entry
109385146         CDS       T04661                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01524  Platinum drug resistance
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04060  Cytokine-cytokine receptor interaction
hai04068  FoxO signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04217  Necroptosis
hai04650  Natural killer cell mediated cytotoxicity
hai04722  Neurotrophin signaling pathway
hai04932  Non-alcoholic fatty liver disease
hai04940  Type I diabetes mellitus
hai05022  Pathways of neurodegeneration - multiple diseases
hai05142  Chagas disease
hai05143  African trypanosomiasis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05162  Measles
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05168  Herpes simplex virus 1 infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05320  Autoimmune thyroid disease
hai05330  Allograft rejection
hai05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109385146 (FASLG)
   04014 Ras signaling pathway
    109385146 (FASLG)
   04068 FoxO signaling pathway
    109385146 (FASLG)
   04151 PI3K-Akt signaling pathway
    109385146 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109385146 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109385146 (FASLG)
   04217 Necroptosis
    109385146 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109385146 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109385146 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109385146 (FASLG)
   05205 Proteoglycans in cancer
    109385146 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109385146 (FASLG)
   05330 Allograft rejection
    109385146 (FASLG)
   05332 Graft-versus-host disease
    109385146 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    109385146 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109385146 (FASLG)
   04932 Non-alcoholic fatty liver disease
    109385146 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109385146 (FASLG)
   05162 Measles
    109385146 (FASLG)
   05164 Influenza A
    109385146 (FASLG)
   05161 Hepatitis B
    109385146 (FASLG)
   05160 Hepatitis C
    109385146 (FASLG)
   05168 Herpes simplex virus 1 infection
    109385146 (FASLG)
   05163 Human cytomegalovirus infection
    109385146 (FASLG)
   05165 Human papillomavirus infection
    109385146 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109385146 (FASLG)
   05143 African trypanosomiasis
    109385146 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109385146 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109385146 (FASLG)
   04052 Cytokines and growth factors [BR:hai04052]
    109385146 (FASLG)
   04090 CD molecules [BR:hai04090]
    109385146 (FASLG)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109385146 (FASLG)
Cytokines and growth factors [BR:hai04052]
 Cytokines
  Tumor necrosis fators
   109385146 (FASLG)
CD molecules [BR:hai04090]
 Proteins
  109385146 (FASLG)
SSDB
Motif
Pfam: TNF GutM LapA_dom
Other DBs
NCBI-GeneID: 109385146
NCBI-ProteinID: XP_019502628
LinkDB
Position
Un
AA seq 277 aa
MQQPLNYPYPQIYWVDSSASSPWAPPGSVLPCPSSVPRRPGQRRPPPPPPPPPPPPLPLP
PLPLPPLKKQRGHSTGLCLLLMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQRHIA
SSLEKHIGHPSPSPEKKELRKLAHLTGKPNSRAIPLEWEDTYGIALVSGVKYKKGGLVIN
DTGPYFVYSKVYFRGQSCNNQPLSHRVYVRNSKYPEDLVLMEGKMMDYCTAGRMWARSSY
LGAVFNLTTADHLYVNVSALSLVNFEESKTFFGLYKL
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcagcagcccttgaactacccatacccccagatctactgggtggacagcagtgccagc
tctccctgggcccctccagggtcagtcctcccatgtccgtcctcggtgcctagaaggcct
ggtcaaaggaggccaccaccaccaccgccgccgccaccgccgcccccattgccgttgcca
ccactgccattgccacctctgaagaagcaaaggggccacagcacaggcctgtgtctcctt
ctgatgtttttcatggtgctggtggccctggttggattggggctggggatgtttcagctg
ttccacctacagaaggagctggctgagctcagagagtccaccagccaaagacatatagca
tcatctctggagaagcatataggtcaccccagtccatcccctgaaaaaaaggagctgagg
aaattggcccacttaacagggaagcccaactcaagagccatccctctggaatgggaagac
acctatggcattgccctggtctccggcgtgaagtataagaagggcggccttgtgatcaat
gacactgggccctacttcgtgtattccaaagtgtacttccggggtcagtcctgcaacaac
cagcccttgagccacagggtctatgtgaggaactctaagtatcctgaggacctggtgctc
atggaggggaagatgatggactactgcactgctggccggatgtgggcccgcagcagctac
ctgggggccgtgttcaacctcaccactgctgaccatttatatgtcaatgtgtctgcgctc
tctctggtcaattttgaggaatctaagacattttttggcttatataagctctga

DBGET integrated database retrieval system