KEGG   Hipposideros armiger (great roundleaf bat): 109385186
Entry
109385186         CDS       T04661                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00230  Purine metabolism
hai01100  Metabolic pathways
hai01522  Endocrine resistance
hai04015  Rap1 signaling pathway
hai04020  Calcium signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04072  Phospholipase D signaling pathway
hai04114  Oocyte meiosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04261  Adrenergic signaling in cardiomyocytes
hai04270  Vascular smooth muscle contraction
hai04371  Apelin signaling pathway
hai04540  Gap junction
hai04611  Platelet activation
hai04713  Circadian entrainment
hai04714  Thermogenesis
hai04723  Retrograde endocannabinoid signaling
hai04724  Glutamatergic synapse
hai04725  Cholinergic synapse
hai04727  GABAergic synapse
hai04740  Olfactory transduction
hai04750  Inflammatory mediator regulation of TRP channels
hai04911  Insulin secretion
hai04912  GnRH signaling pathway
hai04913  Ovarian steroidogenesis
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04916  Melanogenesis
hai04918  Thyroid hormone synthesis
hai04921  Oxytocin signaling pathway
hai04923  Regulation of lipolysis in adipocytes
hai04925  Aldosterone synthesis and secretion
hai04926  Relaxin signaling pathway
hai04927  Cortisol synthesis and secretion
hai04928  Parathyroid hormone synthesis, secretion and action
hai04934  Cushing syndrome
hai04935  Growth hormone synthesis, secretion and action
hai04962  Vasopressin-regulated water reabsorption
hai04970  Salivary secretion
hai04971  Gastric acid secretion
hai04972  Pancreatic secretion
hai04976  Bile secretion
hai05032  Morphine addiction
hai05163  Human cytomegalovirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05200  Pathways in cancer
hai05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109385186 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109385186 (ADCY3)
   04371 Apelin signaling pathway
    109385186 (ADCY3)
   04020 Calcium signaling pathway
    109385186 (ADCY3)
   04072 Phospholipase D signaling pathway
    109385186 (ADCY3)
   04024 cAMP signaling pathway
    109385186 (ADCY3)
   04022 cGMP-PKG signaling pathway
    109385186 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109385186 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109385186 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109385186 (ADCY3)
   04062 Chemokine signaling pathway
    109385186 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    109385186 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    109385186 (ADCY3)
   04912 GnRH signaling pathway
    109385186 (ADCY3)
   04913 Ovarian steroidogenesis
    109385186 (ADCY3)
   04915 Estrogen signaling pathway
    109385186 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    109385186 (ADCY3)
   04921 Oxytocin signaling pathway
    109385186 (ADCY3)
   04926 Relaxin signaling pathway
    109385186 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    109385186 (ADCY3)
   04918 Thyroid hormone synthesis
    109385186 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    109385186 (ADCY3)
   04916 Melanogenesis
    109385186 (ADCY3)
   04925 Aldosterone synthesis and secretion
    109385186 (ADCY3)
   04927 Cortisol synthesis and secretion
    109385186 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109385186 (ADCY3)
   04270 Vascular smooth muscle contraction
    109385186 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    109385186 (ADCY3)
   04971 Gastric acid secretion
    109385186 (ADCY3)
   04972 Pancreatic secretion
    109385186 (ADCY3)
   04976 Bile secretion
    109385186 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109385186 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    109385186 (ADCY3)
   04727 GABAergic synapse
    109385186 (ADCY3)
   04725 Cholinergic synapse
    109385186 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    109385186 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    109385186 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    109385186 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    109385186 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    109385186 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109385186 (ADCY3)
   04714 Thermogenesis
    109385186 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109385186 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    109385186 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109385186 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109385186 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109385186 (ADCY3)
   05163 Human cytomegalovirus infection
    109385186 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109385186 (ADCY3)
Enzymes [BR:hai01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109385186 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N NCE101
Other DBs
NCBI-GeneID: 109385186
NCBI-ProteinID: XP_019502725
LinkDB
Position
Un
AA seq 1145 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLVVAGIGLLLDVI
LFVLCKKGLLPTRVTRKVVPYLLWLLITAQVFSYLGLNFAHAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVASCVVHTLVLGVTVAQQQQDGLKGMQLLREILANVFLYLCAIIVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTLNCLKGEFDVEPGDGGSRCD
YLDEKGIETYLVIASKPEVKKTATQNGLNGSALPNGAPASSKPSSPALIETKEPNGSVHT
SGSTSEEPEEQDGQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFVVGEVLLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMSN
TVDMLSCLQYYMGPNGTAGMEIEDGCMENPKYYNYIAVLSLIATIMLVQVSHMVKLTLML
LVTGAVAVINIYAWRPIFDEYDRRRFQKHDSFSMVAVEKMQIFSTPGLNGTDRLSLVPSK
YSMTVMVFVMMLSFYYFSRHVEKLARTLFLWKIEVHEQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQAILREYGFRFVRRGPIFVKGKGELLTFFLKGREKPATFPNGSSVTLPHQ
VLDSA
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgaccctgagtactcagcggagtactccgccgaatac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctctgtg
cggaactcggggtcctgcctctgcctgcctcgtttcatgcggctgaccttcgtgcccgag
tccttggagaacctataccagacctacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtcttcgcagccctcttcgactgctatgtggtggtcatgtgcgctgtggtcttc
tccagcgacaagctggctcccctcgtggtggccggcatcggtctgctgttggatgtcatc
ctcttcgtgctctgcaaaaaggggctgctcccgacccgggtcacccggaaagtggtgccg
tacctgctgtggctgctgataacagcccaggtcttctcctacctgggattgaactttgcc
cacgcccacgcggccagcgacacagtgggttggcaggccttctttgtcttctccttcttc
atcacgctgccgctcagcctcagccccattgtcatcatctctgtggcctcctgtgttgtg
cacacgcttgtcttgggggtcaccgtggcccagcagcagcaggacgggctgaaggggatg
caattgctgagagagatcttggccaacgtcttcctctacctgtgcgccatcatcgtgggt
atcatgtcctactacatggcggaccggaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatc
ctcttcgccgacattgtgggcttcacccagctgtcctctgcctgcagcgcccaggagctc
gtgaagctgctcaatgagctcttcgcccgcttcgacaagctggcggccaaataccaccag
ctgcggattaagatcctgggtgactgctactactgcatctgtggcctgcctgactaccgg
gaggaccatgccgtctgctccatcctcatggggctcgccatggtggaagccatctcgtac
gtgcgggagaagacgaagaccggagtggacatgcgtgtgggggtgcacacgggcactgtg
ctggggggcgtcctgggccagaagcgctggcagtacgacgtgtggtctaccgacgtcacg
gtggccaacaaaatggaggccggtggcatccctgggcgcgttcacatctcccagagcacc
ttgaactgcctgaaaggagagtttgacgtggagccaggcgatgggggcagccgctgcgat
tacctagatgagaagggcatcgaaacctacctcgtcattgcgtccaagccggaggtgaag
aaaacagccactcaaaatggcctcaacggctcggccctgcccaatggagcgccagcttcc
tcaaagcccagctcccctgccctcattgaaaccaaggagcccaatgggagtgtccacacc
agcggttccacatccgaggagcccgaggagcaagatggccaggccgacaacccctcattc
ccaaaccctcgccggaggctgcgccttcaggacctggccgatcgcgtggtggacgcctca
gaggacgagcacgagctcaaccagctgctcaacgaggccttgcttgagcgggagtcagcc
caggtagtgaagaagagaaacaccttcctcttatccatgcggttcatggaccccgagatg
gaaacccggtactcggtggagaaggaaaagcagagtggagcggcctttagctgctcctgc
gtggtcctgctctgtacggctctggtcgagatcctcattgacccctggctaatgacaaac
tatgtgacctttgtggttggggaggttctgcttctgatcctgaccatctgctcgctggct
gccatctttccccgggcctttcctaagaagctcgtggccttctcgacttggattgaccgg
actcgctgggccagaaacacctgggccatgttagccatcttcattctggtcatgtcaaac
actgtagacatgcttagctgcctccagtactacatgggacccaacggcactgcagggatg
gagatagaggatggctgcatggagaaccccaagtattacaactacatcgccgtgctgtcc
ctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatgctg
ctcgtcacgggcgctgtggccgtcatcaacatctatgcctggcgccccatctttgatgaa
tatgaccgcagacgtttccagaaacacgacagcttttctatggttgccgtagagaagatg
cagatattctccacccccgggctcaacggcactgacaggctgtccctggtgccttctaag
tactcgatgacagtgatggtcttcgtcatgatgctgagtttctactacttctcccgccac
gtggaaaaactggcacggacactgttcttgtggaagattgaggtccatgaacagaaggaa
cgtgtctatgagatgcgacgctggaatgaggccttggtcaccaacatgttgcctgagcac
gtggcacgccatttcctgggttccaagaagagagatgaggagctgtacagccagtcttat
gatgagattggagtcatgtttgcctccctgcccaactttgccgacttctacaccgaggag
agcatcaataatggtggcattgagtgtctgcgcttcctcaacgagatcatttcggatttt
gactccctcctggacaatcccaaattccgggtcatcaccaagatcaaaaccattggcagc
acctatatggcagcttcaggagtcacccccgatgtcaacaccaatggctttaccagctcc
aacaaggaggaaaagtcagacaaggagcgctggcagcacctggctgacctggcggacttc
gccctcgccatgaaggatacgcttacaaacatcaacaaccagtccttcaacaacttcatg
ctgcgcataggcatgaacaaaggaggggtactggctggggtcattggagcccggaaacca
cactacgatatctggggcaatacagtcaacgtagccagcagaatggagtccaccggcgtc
atgggcaacattcaggtggtagaagaaacgcaagccatccttcgagagtacggcttccgc
tttgtgaggcgagggcccatctttgtgaaggggaagggggagctgctcaccttcttcctg
aaggggcgcgagaagcccgccaccttccccaacggctcctcggtcacgctgccccaccag
gtactagacagcgcctga

DBGET integrated database retrieval system