KEGG   Hipposideros armiger (great roundleaf bat): 109385252
Entry
109385252         CDS       T04661                                 

Gene name
MAP2K1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04114  Oocyte meiosis
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04218  Cellular senescence
hai04270  Vascular smooth muscle contraction
hai04370  VEGF signaling pathway
hai04371  Apelin signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04540  Gap junction
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04620  Toll-like receptor signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04726  Serotonergic synapse
hai04730  Long-term depression
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04912  GnRH signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04916  Melanogenesis
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04921  Oxytocin signaling pathway
hai04926  Relaxin signaling pathway
hai04928  Parathyroid hormone synthesis, secretion and action
hai04929  GnRH secretion
hai04934  Cushing syndrome
hai04935  Growth hormone synthesis, secretion and action
hai05010  Alzheimer disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05034  Alcoholism
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109385252 (MAP2K1)
   04012 ErbB signaling pathway
    109385252 (MAP2K1)
   04014 Ras signaling pathway
    109385252 (MAP2K1)
   04015 Rap1 signaling pathway
    109385252 (MAP2K1)
   04370 VEGF signaling pathway
    109385252 (MAP2K1)
   04371 Apelin signaling pathway
    109385252 (MAP2K1)
   04668 TNF signaling pathway
    109385252 (MAP2K1)
   04066 HIF-1 signaling pathway
    109385252 (MAP2K1)
   04068 FoxO signaling pathway
    109385252 (MAP2K1)
   04072 Phospholipase D signaling pathway
    109385252 (MAP2K1)
   04071 Sphingolipid signaling pathway
    109385252 (MAP2K1)
   04024 cAMP signaling pathway
    109385252 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    109385252 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    109385252 (MAP2K1)
   04150 mTOR signaling pathway
    109385252 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109385252 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    109385252 (MAP2K1)
   04210 Apoptosis
    109385252 (MAP2K1)
   04218 Cellular senescence
    109385252 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109385252 (MAP2K1)
   04540 Gap junction
    109385252 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    109385252 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109385252 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109385252 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    109385252 (MAP2K1)
   04660 T cell receptor signaling pathway
    109385252 (MAP2K1)
   04662 B cell receptor signaling pathway
    109385252 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    109385252 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    109385252 (MAP2K1)
   04062 Chemokine signaling pathway
    109385252 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109385252 (MAP2K1)
   04929 GnRH secretion
    109385252 (MAP2K1)
   04912 GnRH signaling pathway
    109385252 (MAP2K1)
   04915 Estrogen signaling pathway
    109385252 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    109385252 (MAP2K1)
   04917 Prolactin signaling pathway
    109385252 (MAP2K1)
   04921 Oxytocin signaling pathway
    109385252 (MAP2K1)
   04926 Relaxin signaling pathway
    109385252 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    109385252 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    109385252 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    109385252 (MAP2K1)
   04916 Melanogenesis
    109385252 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109385252 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    109385252 (MAP2K1)
   04726 Serotonergic synapse
    109385252 (MAP2K1)
   04720 Long-term potentiation
    109385252 (MAP2K1)
   04730 Long-term depression
    109385252 (MAP2K1)
   04722 Neurotrophin signaling pathway
    109385252 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109385252 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109385252 (MAP2K1)
   05206 MicroRNAs in cancer
    109385252 (MAP2K1)
   05205 Proteoglycans in cancer
    109385252 (MAP2K1)
   05230 Central carbon metabolism in cancer
    109385252 (MAP2K1)
   05231 Choline metabolism in cancer
    109385252 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109385252 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109385252 (MAP2K1)
   05212 Pancreatic cancer
    109385252 (MAP2K1)
   05225 Hepatocellular carcinoma
    109385252 (MAP2K1)
   05226 Gastric cancer
    109385252 (MAP2K1)
   05214 Glioma
    109385252 (MAP2K1)
   05216 Thyroid cancer
    109385252 (MAP2K1)
   05221 Acute myeloid leukemia
    109385252 (MAP2K1)
   05220 Chronic myeloid leukemia
    109385252 (MAP2K1)
   05218 Melanoma
    109385252 (MAP2K1)
   05211 Renal cell carcinoma
    109385252 (MAP2K1)
   05219 Bladder cancer
    109385252 (MAP2K1)
   05215 Prostate cancer
    109385252 (MAP2K1)
   05213 Endometrial cancer
    109385252 (MAP2K1)
   05224 Breast cancer
    109385252 (MAP2K1)
   05223 Non-small cell lung cancer
    109385252 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109385252 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    109385252 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    109385252 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109385252 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109385252 (MAP2K1)
   05135 Yersinia infection
    109385252 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109385252 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    109385252 (MAP2K1)
   05164 Influenza A
    109385252 (MAP2K1)
   05161 Hepatitis B
    109385252 (MAP2K1)
   05160 Hepatitis C
    109385252 (MAP2K1)
   05163 Human cytomegalovirus infection
    109385252 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109385252 (MAP2K1)
   05165 Human papillomavirus infection
    109385252 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109385252 (MAP2K1)
   01522 Endocrine resistance
    109385252 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109385252 (MAP2K1)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     109385252 (MAP2K1)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: STE group
  STE7 family
   109385252 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 109385252
NCBI-ProteinID: XP_019502864
LinkDB
Position
Un
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccagccccagacggctccgcggtt
aacgggaccagctcggcggagaccaacctggaggctttgcagaagaagctggaggagctg
gagcttgacgagcagcagcggaagcgcctcgaggcctttcttacccagaagcagaaagtg
ggggaactaaaggatgacgacttcgagaagatcagtgagctgggtgctggcaatggcggc
gtggtgttcaaggtctcccacaagccatccggcctggtcatggccagaaagctaattcac
ctagagatcaaaccagcaatccggaaccagatcataagggaactgcaggttctccatgag
tgtaactccccatacatcgtgggcttctatggtgccttttacagtgatggcgagatcagc
atctgcatggagcacatggatgggggttccttggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacatatctg
agggagaagcacaagattatgcatagagatgtcaagccttccaacatcctagtgaactct
cgtggggagatcaagctctgtgactttggggttagcggacagctcatcgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccagggtactcactac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcgattgggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttgggtgccaggtggag
ggagatgcggctgagacaccgcctaggccaaggacccctgggaggcccctcagctcttat
ggaatggacagccgacctcccatggcaatttttgagttgttggattatatagtcaatgag
cctcctccaaaactgcccagtggagtattcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaatcctgcagagagggccgacttgaagcagctcatggttcatgctttt
atcaagagatctgatgctgaggaagtggattttgctggttggctctgctctaccattggc
cttaaccagcctagcacaccaacccatgcggctggtgtctaa

KEGG   Hipposideros armiger (great roundleaf bat): 109388626
Entry
109388626         CDS       T04661                                 

Gene name
MAP2K2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04218  Cellular senescence
hai04270  Vascular smooth muscle contraction
hai04370  VEGF signaling pathway
hai04371  Apelin signaling pathway
hai04540  Gap junction
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04620  Toll-like receptor signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04730  Long-term depression
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04912  GnRH signaling pathway
hai04915  Estrogen signaling pathway
hai04916  Melanogenesis
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04921  Oxytocin signaling pathway
hai04926  Relaxin signaling pathway
hai04929  GnRH secretion
hai04934  Cushing syndrome
hai04935  Growth hormone synthesis, secretion and action
hai05010  Alzheimer disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05132  Salmonella infection
hai05135  Yersinia infection
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109388626 (MAP2K2)
   04012 ErbB signaling pathway
    109388626 (MAP2K2)
   04014 Ras signaling pathway
    109388626 (MAP2K2)
   04015 Rap1 signaling pathway
    109388626 (MAP2K2)
   04370 VEGF signaling pathway
    109388626 (MAP2K2)
   04371 Apelin signaling pathway
    109388626 (MAP2K2)
   04066 HIF-1 signaling pathway
    109388626 (MAP2K2)
   04068 FoxO signaling pathway
    109388626 (MAP2K2)
   04072 Phospholipase D signaling pathway
    109388626 (MAP2K2)
   04071 Sphingolipid signaling pathway
    109388626 (MAP2K2)
   04024 cAMP signaling pathway
    109388626 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    109388626 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    109388626 (MAP2K2)
   04150 mTOR signaling pathway
    109388626 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109388626 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    109388626 (MAP2K2)
   04218 Cellular senescence
    109388626 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109388626 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    109388626 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109388626 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109388626 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    109388626 (MAP2K2)
   04660 T cell receptor signaling pathway
    109388626 (MAP2K2)
   04662 B cell receptor signaling pathway
    109388626 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    109388626 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109388626 (MAP2K2)
   04929 GnRH secretion
    109388626 (MAP2K2)
   04912 GnRH signaling pathway
    109388626 (MAP2K2)
   04915 Estrogen signaling pathway
    109388626 (MAP2K2)
   04917 Prolactin signaling pathway
    109388626 (MAP2K2)
   04921 Oxytocin signaling pathway
    109388626 (MAP2K2)
   04926 Relaxin signaling pathway
    109388626 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    109388626 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    109388626 (MAP2K2)
   04916 Melanogenesis
    109388626 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109388626 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    109388626 (MAP2K2)
   04730 Long-term depression
    109388626 (MAP2K2)
   04722 Neurotrophin signaling pathway
    109388626 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109388626 (MAP2K2)
   05206 MicroRNAs in cancer
    109388626 (MAP2K2)
   05205 Proteoglycans in cancer
    109388626 (MAP2K2)
   05230 Central carbon metabolism in cancer
    109388626 (MAP2K2)
   05231 Choline metabolism in cancer
    109388626 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109388626 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109388626 (MAP2K2)
   05225 Hepatocellular carcinoma
    109388626 (MAP2K2)
   05226 Gastric cancer
    109388626 (MAP2K2)
   05214 Glioma
    109388626 (MAP2K2)
   05216 Thyroid cancer
    109388626 (MAP2K2)
   05221 Acute myeloid leukemia
    109388626 (MAP2K2)
   05220 Chronic myeloid leukemia
    109388626 (MAP2K2)
   05218 Melanoma
    109388626 (MAP2K2)
   05211 Renal cell carcinoma
    109388626 (MAP2K2)
   05219 Bladder cancer
    109388626 (MAP2K2)
   05215 Prostate cancer
    109388626 (MAP2K2)
   05213 Endometrial cancer
    109388626 (MAP2K2)
   05224 Breast cancer
    109388626 (MAP2K2)
   05223 Non-small cell lung cancer
    109388626 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109388626 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    109388626 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109388626 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109388626 (MAP2K2)
   05135 Yersinia infection
    109388626 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109388626 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    109388626 (MAP2K2)
   05164 Influenza A
    109388626 (MAP2K2)
   05161 Hepatitis B
    109388626 (MAP2K2)
   05160 Hepatitis C
    109388626 (MAP2K2)
   05163 Human cytomegalovirus infection
    109388626 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109388626 (MAP2K2)
   05165 Human papillomavirus infection
    109388626 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109388626 (MAP2K2)
   01522 Endocrine resistance
    109388626 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109388626 (MAP2K2)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     109388626 (MAP2K2)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: STE group
  STE7 family
   109388626 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo CAMSAP_CC1
Other DBs
NCBI-GeneID: 109388626
NCBI-ProteinID: XP_019509046
LinkDB
Position
Un
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGAEGESHSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFTQDFQDFVNKCLIKNPAERADL
KMLMNHAFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgttgccggcgctcactatcaaccccgccatcgccgag
ggtccgtcccccaccagcgagggcgcctccgaagcaaacttggtggacctccagaagaag
ctagaggagctagagcttgatgagcagcagaagaagcggctagaagccttcctcacccag
aaagccaaggtcggggagctcaaggacgatgattttgaaaggatctcggagctgggagcc
gggaacggcggggtagtcaccaaggtccagcatagaccttcgggcctcatcatggcaaga
aagctgattcacctggagatcaagccagccatccggaaccagataatccgtgagctgcag
gtgctgcacgagtgtaactcgccgtacatcgtgggcttctacggggccttctatagcgac
ggagagatcagcatctgtatggagcacatggacggtggctctttggaccaggtgttgaaa
gaagccaagagaattccagaagagatcctggggaaggtcagcatcgcggttctccggggc
ctggcatatctccgggagaagcaccagatcatgcaccgagatgtgaaaccgtccaacatc
ctcgtcaactccagaggggagataaagctgtgtgactttggggtgagcgggcagctcatc
gactccatggccaactctttcgtgggaacgcgatcctacatgtccccagagcggttgcaa
ggcactcactactcggtgcagtcggacatctggagcatgggcctgtcactggtggagctg
tccattggaaggtaccccatccccccaccagacgccaaggagctggaggccatatttggc
cggcccatggtcgatggggcagaaggagagtctcatagcatctcaccacggccaagaccc
cctggacgccccataagcggtcacgggatggacagccggccggctatggctatcttcgag
ctgctggactacattgtgaacgaacctcctcccaagctgcctagcggtgttttcacccag
gacttccaggattttgtgaataaatgcctaattaagaacccagccgagcgagcggatctg
aagatgctcatgaaccacgccttcatcaaacggtccgaggtggaagaagtggattttgcc
ggttggttgtgtaaaacgctgcgtctgaaccagcccagcacgcccacacgcaccgccgtg
tga

DBGET integrated database retrieval system