KEGG   Hipposideros armiger (great roundleaf bat): 109385259
Entry
109385259         CDS       T04661                                 

Gene name
RAB11A
Definition
(RefSeq) RAB11A, member RAS oncogene family
  KO
K07904  Ras-related protein Rab-11A
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04144  Endocytosis
hai04961  Endocrine and other factor-regulated calcium reabsorption
hai04962  Vasopressin-regulated water reabsorption
hai04972  Pancreatic secretion
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109385259 (RAB11A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    109385259 (RAB11A)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109385259 (RAB11A)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109385259 (RAB11A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109385259 (RAB11A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109385259 (RAB11A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109385259 (RAB11A)
   04031 GTP-binding proteins [BR:hai04031]
    109385259 (RAB11A)
Membrane trafficking [BR:hai04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    109385259 (RAB11A)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109385259 (RAB11A)
  Exosomal proteins of colorectal cancer cells
   109385259 (RAB11A)
GTP-binding proteins [BR:hai04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    109385259 (RAB11A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran NTPase_1 Gtr1_RagA SRPRB TniB AAA_14 AAA_24 FAD-SLDH MCM AAA_5 AAA_21
Other DBs
NCBI-GeneID: 109385259
NCBI-ProteinID: XP_019502888
LinkDB
Position
Un
AA seq 216 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctcttcaaagttgtccttatcggagattct
ggtgttggaaagagtaatctcctgtctcgatttactcgaaatgagtttaacctcgaaagc
aagagcaccattggagtagagtttgcaacaagaagcatccaggttgatgggaaaacaata
aaggcacagatatgggacacagcagggcaagagcgataccgagctataacatcagcatac
tatcgtggagctgtaggtgccttactggtttatgacattgctaaacatctcacatatgaa
aatgtagagcgatggctgaaagaactgagagatcatgctgatagtaacattgttataatg
cttgtgggcaataagagtgatttgcgtcatctcagggcagttcctacagatgaagcaaga
gcttttgcagaaaagaatggtttgtcattcattgagacgtctgctttagactctacaaat
gtagaagctgcttttcagacaattctgacagagatataccgcattgtttcccagaagcaa
atgtcagacagacgtgaaaatgacatgtctccaagcaacaatgtggttcctattcatgtt
ccaccaaccactgaaaacaagccaaaggtgcaatgctgtcagaacatataa

KEGG   Hipposideros armiger (great roundleaf bat): 109396105
Entry
109396105         CDS       T04661                                 

Gene name
RAB11B
Definition
(RefSeq) RAB11B, member RAS oncogene family
  KO
K07905  Ras-related protein Rab-11B
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04144  Endocytosis
hai04152  AMPK signaling pathway
hai04962  Vasopressin-regulated water reabsorption
hai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    109396105 (RAB11B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109396105 (RAB11B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109396105 (RAB11B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    109396105 (RAB11B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109396105 (RAB11B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109396105 (RAB11B)
   04031 GTP-binding proteins [BR:hai04031]
    109396105 (RAB11B)
Membrane trafficking [BR:hai04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    109396105 (RAB11B)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109396105 (RAB11B)
  Exosomal proteins of other body fluids (saliva and urine)
   109396105 (RAB11B)
  Exosomal proteins of colorectal cancer cells
   109396105 (RAB11B)
GTP-binding proteins [BR:hai04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    109396105 (RAB11B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran Gtr1_RagA NTPase_1 SRPRB TniB AAA_14 FAD-SLDH AAA_24 Ploopntkinase3 AAA_5 AAA_21
Other DBs
NCBI-GeneID: 109396105
NCBI-ProteinID: XP_019523240
LinkDB
Position
Un
AA seq 218 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
NT seq 657 nt   +upstreamnt  +downstreamnt
atggggacccgggacgacgaatacgactacttattcaaagtggtgctcatcggggactca
ggcgtggggaagagcaacctgctgtcccgcttcacccgcaacgagttcaacctggagagc
aagagcaccatcggtgtggagtttgccactcgcagcatccaggtggacggcaagaccatc
aaggcacagatctgggataccgccggccaggagcgctaccgcgccatcacctctgcgtac
taccgaggtgcagtgggcgcactgctggtgtatgacatcgccaagcacctgacatatgag
aatgtggagcgctggctgaaggagctgcgggaccacgccgacagcaacatcgtcatcatg
ctggtgggcaacaagagcgacctgcgccacctgcgggctgtgcccactgacgaggcccga
gccttcgcagaaaagaacaacttgtccttcattgagacctcagccttggactccaccaac
gtagaggaagctttcaagaacatcctcacagagatctaccgcattgtgtcacagaagcag
atagcagaccgcgcagcgcacgatgagtcccccggcaacaatgtggtggacatcagcgtc
ccgcccacgaccgacggacagaaaccgaacaagctacagtgctgccagaacctgtga

DBGET integrated database retrieval system