KEGG   Hipposideros armiger (great roundleaf bat): 109385384
Entry
109385384         CDS       T04661                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04915  Estrogen signaling pathway
hai05200  Pathways in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05223  Non-small cell lung cancer
hai05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109385384 (TGFA)
   04012 ErbB signaling pathway
    109385384 (TGFA)
   04014 Ras signaling pathway
    109385384 (TGFA)
   04151 PI3K-Akt signaling pathway
    109385384 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    109385384 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109385384 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109385384 (TGFA)
   05212 Pancreatic cancer
    109385384 (TGFA)
   05225 Hepatocellular carcinoma
    109385384 (TGFA)
   05214 Glioma
    109385384 (TGFA)
   05211 Renal cell carcinoma
    109385384 (TGFA)
   05215 Prostate cancer
    109385384 (TGFA)
   05223 Non-small cell lung cancer
    109385384 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109385384 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 DUF1180
Other DBs
NCBI-GeneID: 109385384
NCBI-ProteinID: XP_019503160
LinkDB
Position
Un
AA seq 160 aa
MVTSAGQLALFALGLLLAVCQALENTTSALSADPPVAAAVVSYFNDCPDSHSQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVASSQKKQAITALVVVSVVAVAGLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcacctcggctggacagctcgccctgttcgcgctgggtcttttattggctgtgtgc
caggccctggagaacaccacatccgccctgagtgcagacccacccgtggctgcagctgtg
gtgtcctattttaatgactgcccggattcccacagtcagttttgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctgggtatgttggagca
cgctgtgagcacgcggacctcctggctgtggtggcctccagccagaagaagcaggccatc
accgccttggtggtggtctccgtcgtggccgtagctggtctcatcatcacgtgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgagccctcatctgccggcat
gagaagcccagtgccctactgaaaggaaggactgcttgctgccactcagaaacagtagtc
tga

DBGET integrated database retrieval system