KEGG   Hipposideros armiger (great roundleaf bat): 109385740
Entry
109385740         CDS       T04661                                 

Gene name
TLR4
Definition
(RefSeq) toll like receptor 4
  KO
K10160  toll-like receptor 4
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04064  NF-kappa B signaling pathway
hai04066  HIF-1 signaling pathway
hai04145  Phagosome
hai04151  PI3K-Akt signaling pathway
hai04217  Necroptosis
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai05132  Salmonella infection
hai05133  Pertussis
hai05134  Legionellosis
hai05135  Yersinia infection
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05144  Malaria
hai05145  Toxoplasmosis
hai05146  Amoebiasis
hai05152  Tuberculosis
hai05161  Hepatitis B
hai05162  Measles
hai05164  Influenza A
hai05170  Human immunodeficiency virus 1 infection
hai05205  Proteoglycans in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05321  Inflammatory bowel disease
hai05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109385740 (TLR4)
   04066 HIF-1 signaling pathway
    109385740 (TLR4)
   04151 PI3K-Akt signaling pathway
    109385740 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109385740 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    109385740 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109385740 (TLR4)
   04621 NOD-like receptor signaling pathway
    109385740 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109385740 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109385740 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109385740 (TLR4)
   05321 Inflammatory bowel disease
    109385740 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109385740 (TLR4)
   05135 Yersinia infection
    109385740 (TLR4)
   05133 Pertussis
    109385740 (TLR4)
   05134 Legionellosis
    109385740 (TLR4)
   05152 Tuberculosis
    109385740 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109385740 (TLR4)
   05162 Measles
    109385740 (TLR4)
   05164 Influenza A
    109385740 (TLR4)
   05161 Hepatitis B
    109385740 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109385740 (TLR4)
   05144 Malaria
    109385740 (TLR4)
   05145 Toxoplasmosis
    109385740 (TLR4)
   05140 Leishmaniasis
    109385740 (TLR4)
   05142 Chagas disease
    109385740 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109385740 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hai04054]
    109385740 (TLR4)
   04090 CD molecules [BR:hai04090]
    109385740 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:hai00536]
    109385740 (TLR4)
Membrane trafficking [BR:hai04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    109385740 (TLR4)
Pattern recognition receptors [BR:hai04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   109385740 (TLR4)
CD molecules [BR:hai04090]
 Proteins
  109385740 (TLR4)
Glycosaminoglycan binding proteins [BR:hai00536]
 Hyaluronan
  Cell surface receptors
   109385740 (TLR4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_5 LRR_9 DUF1863 LRRCT
Other DBs
NCBI-GeneID: 109385740
NCBI-ProteinID: XP_019503824
LinkDB
Position
Un
AA seq 841 aa
MKAPTRLAGTLILAMAFLSCLRPESWDPCVQVVPHVTYQCMELGLYKIPGNIPTSAKKLD
LSFNPLRRLRSYSFSNFSELQVLDLSRCEIQIIEDDAHQGLKHLSTLILTGNPIQSLAKG
AFSGLSSLQTLVAVEINLASLEDFPIGHLKTLKKLNVAHNFINSFKLPEYFANLADLEYL
DLSNNKIQNIYHEDLLVLHQMPPFKLSLDLSLNPLDFIQQNAFKEIKLQELTVRSNFNST
DVMKTCIQSLAGLKINQLVLGEFKNERAIKELDKSALEGLCNVSMEEFRLAFLRDFSEDD
AGFFHCLANVSRISFLGLNFNKLGGLSKDFRWQYLELANSKFEHFPTLELDSLKTFIFTD
NKVLNPFTEVNLPKLEFLDLSRNDLTFKGCCSHSDLGTTRLKHLDLSFNDAITMSSNFLG
LEQLEHLDFQHSTLKQASDFSVFLSLKNLLYLDISYTNTRIVFHGIFDGLFSLRVLKMAG
NSFQDNFLPSIFTNMTSLTSLDVSKCQLERVSQGAFGSLPNLRLLNMSRNNLLFLDTLPY
QSLHSLRILDCSFNRIVAFTRQELPLFPSSLASLNLTENHFACVCEHLSFLQWVKDHRHL
LVDSEQMLCVNPSEMQGVPVLSFRNSTCQMNKTAVAVSVLSVLVISVVAVLVYKFYFHLM
LLAGCKQYGRGESTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFHLCLHYRDFIPGVAIA
ANIIQEGFHKSRKVIVVVSRHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKSLL
RQQVELYRLLSRNTYLEWEDSGLGRHIFWRRLRKALLDGKAWIPERTADAESSQHSATTP
T
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgaaggctcccacccgcctggctgggactctgatcctagccatggccttcctctcctgc
ctgagacccgagagctgggacccttgtgtgcaggtggtgcctcacgtcacgtatcagtgc
atggagctgggtctctacaaaatccccggcaacatccccacgtcagccaagaaactggac
ctgagctttaaccccctgcggcgtttacgcagctatagcttctccaacttctcagaactg
caggtgctagatctatccaggtgtgaaattcagataattgaagatgatgcacatcagggc
ctaaagcatctctccactttgatattgacggggaaccctattcagagtttagccaaggga
gccttttctggactatcaagtttacagacactagtggctgtggagataaacctagcatct
ctagaagacttccccattggacacctgaaaaccttgaagaagcttaatgtggctcacaat
tttatcaattccttcaagttacctgaatattttgctaacctggcggacctggaatacttg
gacctttccaataacaagatccaaaatatttatcatgaagacttgctggttctccatcaa
atgcccccattcaaactctctttagacttgtccctgaaccctttagactttatccaacaa
aatgcctttaaagaaatcaagctccaagaactgactgtgagaagtaattttaatagtaca
gatgtaatgaaaacttgtattcaaagcctagctgggttaaaaatcaatcagttggttcta
ggagaatttaaaaacgaaagagccatcaaagagttggacaaatctgccctggagggactg
tgcaatgtgagcatggaagaatttcggctagcattcttgcgtgacttctcagaggacgat
gctggcttttttcattgtttggcaaacgtttctagaatttcttttttgggtctgaatttc
aacaagctaggaggcctttctaaagacttccgatggcaatatttagaattggctaatagt
aaatttgaacactttcccacattggagcttgactctctcaaaacgtttattttcactgac
aataaagttctgaacccttttactgaagttaacctaccaaaacttgagtttctagatctc
agtagaaatgacttgactttcaagggttgctgttctcattctgatctggggacaaccagg
ctgaaacacttagatctgagcttcaatgatgctatcactatgagttcgaacttcttgggc
ttagagcaactagaacatctggatttccagcattccactttgaaacaggccagtgatttc
tcagtattcctgtcactcaaaaacctcctttaccttgacatttcttatactaacacacgc
attgtcttccatggcatcttcgatggcttgttcagcctccgggtcctgaaaatggctggc
aattcttttcaggacaacttccttccaagtatcttcacaaatatgactagcttgacctcc
ctggacgtctctaagtgtcaactggaacgggtgtcccagggggcatttggctcactccca
aatcttcggttgctaaatatgagtcgcaacaacctcttgttcttggatacacttccttac
caatctcttcactcccttcgcattctggactgcagttttaaccgtatagtggctttcacg
aggcaagagctaccgctgtttccaagcagtctggcttccttaaatctcactgagaatcac
tttgcttgtgtctgtgaacacctgagtttcctgcagtgggtcaaggaccacaggcatctc
ttggtggactctgaacaaatgctgtgtgtgaacccttcagaaatgcagggtgtgccggtg
ctcagtttcaggaattccacctgtcagatgaacaagaccgccgttgctgtgtcagttctc
tctgtccttgtgatatctgtggtggcagttctggtctacaagttctatttccacctgatg
cttcttgctggttgcaaacagtatggcagaggtgaaagcacctatgatgcctttgttatc
tactcaagccaggatgaggactgggtgaggaatgagttggtaaagaacttggaggagggg
gtgcccccctttcatctttgccttcactacagagactttattcctggggtggccattgcc
gccaacatcatccaggaaggtttccacaaaagccggaaggttattgtggtcgtgtcccga
cacttcatccagagtcgatggtgtatctttgagtatgagattgcccagacctggcagttt
ctcagcagtcgggcgggcatcattttcatcgtcctgcagaaggtggagaagtccctgctc
cggcagcaggtggagctgtatcgccttctcagcaggaacacgtacctggagtgggaggac
agtggcctggggcggcacatattctggagacgactcagaaaagccttgctggatggtaaa
gcgtggattccagaaagaacagcagatgcagagagcagccagcactcagcaacaaccccc
acctga

DBGET integrated database retrieval system