KEGG   Hipposideros armiger (great roundleaf bat): 109385803
Entry
109385803         CDS       T04661                                 

Gene name
MAPK3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04114  Oocyte meiosis
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04218  Cellular senescence
hai04261  Adrenergic signaling in cardiomyocytes
hai04270  Vascular smooth muscle contraction
hai04350  TGF-beta signaling pathway
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04371  Apelin signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04520  Adherens junction
hai04540  Gap junction
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04611  Platelet activation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04657  IL-17 signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04713  Circadian entrainment
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04723  Retrograde endocannabinoid signaling
hai04724  Glutamatergic synapse
hai04725  Cholinergic synapse
hai04726  Serotonergic synapse
hai04730  Long-term depression
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04912  GnRH signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04916  Melanogenesis
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04921  Oxytocin signaling pathway
hai04926  Relaxin signaling pathway
hai04928  Parathyroid hormone synthesis, secretion and action
hai04929  GnRH secretion
hai04930  Type II diabetes mellitus
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04934  Cushing syndrome
hai04935  Growth hormone synthesis, secretion and action
hai04960  Aldosterone-regulated sodium reabsorption
hai05010  Alzheimer disease
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05034  Alcoholism
hai05132  Salmonella infection
hai05133  Pertussis
hai05135  Yersinia infection
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109385803 (MAPK3)
   04012 ErbB signaling pathway
    109385803 (MAPK3)
   04014 Ras signaling pathway
    109385803 (MAPK3)
   04015 Rap1 signaling pathway
    109385803 (MAPK3)
   04350 TGF-beta signaling pathway
    109385803 (MAPK3)
   04370 VEGF signaling pathway
    109385803 (MAPK3)
   04371 Apelin signaling pathway
    109385803 (MAPK3)
   04668 TNF signaling pathway
    109385803 (MAPK3)
   04066 HIF-1 signaling pathway
    109385803 (MAPK3)
   04068 FoxO signaling pathway
    109385803 (MAPK3)
   04072 Phospholipase D signaling pathway
    109385803 (MAPK3)
   04071 Sphingolipid signaling pathway
    109385803 (MAPK3)
   04024 cAMP signaling pathway
    109385803 (MAPK3)
   04022 cGMP-PKG signaling pathway
    109385803 (MAPK3)
   04151 PI3K-Akt signaling pathway
    109385803 (MAPK3)
   04150 mTOR signaling pathway
    109385803 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109385803 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    109385803 (MAPK3)
   04210 Apoptosis
    109385803 (MAPK3)
   04218 Cellular senescence
    109385803 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109385803 (MAPK3)
   04520 Adherens junction
    109385803 (MAPK3)
   04540 Gap junction
    109385803 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    109385803 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109385803 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109385803 (MAPK3)
   04620 Toll-like receptor signaling pathway
    109385803 (MAPK3)
   04621 NOD-like receptor signaling pathway
    109385803 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    109385803 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    109385803 (MAPK3)
   04660 T cell receptor signaling pathway
    109385803 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    109385803 (MAPK3)
   04659 Th17 cell differentiation
    109385803 (MAPK3)
   04657 IL-17 signaling pathway
    109385803 (MAPK3)
   04662 B cell receptor signaling pathway
    109385803 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    109385803 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    109385803 (MAPK3)
   04062 Chemokine signaling pathway
    109385803 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109385803 (MAPK3)
   04929 GnRH secretion
    109385803 (MAPK3)
   04912 GnRH signaling pathway
    109385803 (MAPK3)
   04915 Estrogen signaling pathway
    109385803 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    109385803 (MAPK3)
   04917 Prolactin signaling pathway
    109385803 (MAPK3)
   04921 Oxytocin signaling pathway
    109385803 (MAPK3)
   04926 Relaxin signaling pathway
    109385803 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    109385803 (MAPK3)
   04919 Thyroid hormone signaling pathway
    109385803 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    109385803 (MAPK3)
   04916 Melanogenesis
    109385803 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109385803 (MAPK3)
   04270 Vascular smooth muscle contraction
    109385803 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109385803 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    109385803 (MAPK3)
   04725 Cholinergic synapse
    109385803 (MAPK3)
   04726 Serotonergic synapse
    109385803 (MAPK3)
   04720 Long-term potentiation
    109385803 (MAPK3)
   04730 Long-term depression
    109385803 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    109385803 (MAPK3)
   04722 Neurotrophin signaling pathway
    109385803 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    109385803 (MAPK3)
   04380 Osteoclast differentiation
    109385803 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109385803 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109385803 (MAPK3)
   05206 MicroRNAs in cancer
    109385803 (MAPK3)
   05205 Proteoglycans in cancer
    109385803 (MAPK3)
   05203 Viral carcinogenesis
    109385803 (MAPK3)
   05230 Central carbon metabolism in cancer
    109385803 (MAPK3)
   05231 Choline metabolism in cancer
    109385803 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109385803 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109385803 (MAPK3)
   05212 Pancreatic cancer
    109385803 (MAPK3)
   05225 Hepatocellular carcinoma
    109385803 (MAPK3)
   05226 Gastric cancer
    109385803 (MAPK3)
   05214 Glioma
    109385803 (MAPK3)
   05216 Thyroid cancer
    109385803 (MAPK3)
   05221 Acute myeloid leukemia
    109385803 (MAPK3)
   05220 Chronic myeloid leukemia
    109385803 (MAPK3)
   05218 Melanoma
    109385803 (MAPK3)
   05211 Renal cell carcinoma
    109385803 (MAPK3)
   05219 Bladder cancer
    109385803 (MAPK3)
   05215 Prostate cancer
    109385803 (MAPK3)
   05213 Endometrial cancer
    109385803 (MAPK3)
   05224 Breast cancer
    109385803 (MAPK3)
   05223 Non-small cell lung cancer
    109385803 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109385803 (MAPK3)
   05020 Prion disease
    109385803 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    109385803 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    109385803 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109385803 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109385803 (MAPK3)
   04934 Cushing syndrome
    109385803 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109385803 (MAPK3)
   05135 Yersinia infection
    109385803 (MAPK3)
   05133 Pertussis
    109385803 (MAPK3)
   05152 Tuberculosis
    109385803 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109385803 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    109385803 (MAPK3)
   05164 Influenza A
    109385803 (MAPK3)
   05161 Hepatitis B
    109385803 (MAPK3)
   05160 Hepatitis C
    109385803 (MAPK3)
   05163 Human cytomegalovirus infection
    109385803 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109385803 (MAPK3)
   05165 Human papillomavirus infection
    109385803 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109385803 (MAPK3)
   05140 Leishmaniasis
    109385803 (MAPK3)
   05142 Chagas disease
    109385803 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109385803 (MAPK3)
   01524 Platinum drug resistance
    109385803 (MAPK3)
   01522 Endocrine resistance
    109385803 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109385803 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109385803 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109385803 (MAPK3)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109385803 (MAPK3)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109385803 (MAPK3)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109385803 (MAPK3)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109385803 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 109385803
NCBI-ProteinID: XP_019503953
LinkDB
Position
Un
AA seq 325 aa
MVSSAYDHVRETRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEA
MRDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLI
NTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAK
LFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDD
LPKERLKELIFQETARFQPGVLEAP
NT seq 978 nt   +upstreamnt  +downstreamnt
atggtcagctcagcttatgaccacgtgcgcgagacccgcgtggccatcaagaaaatcagc
cccttcgagcatcagacctactgccagcgcacgctgcgagagatccagattttgctgcgt
ttccgccatgagaatgttatcggcatccgggacattcttcgggcacccaccctggaagcc
atgagggatgtctacatcgtgcaggacctgatggagacagacctgtacaagttgctcaaa
agccagcagctgagcaatgaccacgtctgctacttcctctaccagatcctgcggggcctc
aagtatatccactcagccaacgtgctccaccgggatttaaagccctccaacctgctcatc
aacaccacctgtgaccttaagatctgcgattttggcctggcccggatcgccgatcctgag
cacgaccatactggattcctgacagaatatgtggctacacgctggtaccgggcccccgag
atcatgctgaactccaagggctacaccaagtccatcgatatctggtctgtgggctgcatc
ctggcggagatgctctccaaccggcccatcttccctggaaagcactacctggaccagctc
aaccatattctgggtatcctgggctccccctctcaggaggacctgaattgtatcatcaac
atgaaggcacgaaactatctacagtctctgccctccaagaccaaggtggcttgggccaag
ctgttccccaagtcagactccaaagcccttgacctgctggaccggatgttgacctttaac
cccaataagcggatcacagtggaagaagccctggctcacccctacctggaacagtactat
gacccaacagatgagccagtggccgaggaacctttcacttttgacatggagctggatgac
ctacccaaagagcggctgaaggagctcatattccaggagacagcccgcttccagcctggg
gtgctggaggccccctaa

KEGG   Hipposideros armiger (great roundleaf bat): 109394900
Entry
109394900         CDS       T04661                                 

Gene name
MAPK1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai01524  Platinum drug resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04062  Chemokine signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04114  Oocyte meiosis
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04218  Cellular senescence
hai04261  Adrenergic signaling in cardiomyocytes
hai04270  Vascular smooth muscle contraction
hai04350  TGF-beta signaling pathway
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04371  Apelin signaling pathway
hai04380  Osteoclast differentiation
hai04510  Focal adhesion
hai04520  Adherens junction
hai04540  Gap junction
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04611  Platelet activation
hai04620  Toll-like receptor signaling pathway
hai04621  NOD-like receptor signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04657  IL-17 signaling pathway
hai04658  Th1 and Th2 cell differentiation
hai04659  Th17 cell differentiation
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04668  TNF signaling pathway
hai04713  Circadian entrainment
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04723  Retrograde endocannabinoid signaling
hai04724  Glutamatergic synapse
hai04725  Cholinergic synapse
hai04726  Serotonergic synapse
hai04730  Long-term depression
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04912  GnRH signaling pathway
hai04914  Progesterone-mediated oocyte maturation
hai04915  Estrogen signaling pathway
hai04916  Melanogenesis
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04921  Oxytocin signaling pathway
hai04926  Relaxin signaling pathway
hai04928  Parathyroid hormone synthesis, secretion and action
hai04929  GnRH secretion
hai04930  Type II diabetes mellitus
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04934  Cushing syndrome
hai04935  Growth hormone synthesis, secretion and action
hai04960  Aldosterone-regulated sodium reabsorption
hai05010  Alzheimer disease
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05034  Alcoholism
hai05132  Salmonella infection
hai05133  Pertussis
hai05135  Yersinia infection
hai05140  Leishmaniasis
hai05142  Chagas disease
hai05145  Toxoplasmosis
hai05152  Tuberculosis
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05212  Pancreatic cancer
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109394900 (MAPK1)
   04012 ErbB signaling pathway
    109394900 (MAPK1)
   04014 Ras signaling pathway
    109394900 (MAPK1)
   04015 Rap1 signaling pathway
    109394900 (MAPK1)
   04350 TGF-beta signaling pathway
    109394900 (MAPK1)
   04370 VEGF signaling pathway
    109394900 (MAPK1)
   04371 Apelin signaling pathway
    109394900 (MAPK1)
   04668 TNF signaling pathway
    109394900 (MAPK1)
   04066 HIF-1 signaling pathway
    109394900 (MAPK1)
   04068 FoxO signaling pathway
    109394900 (MAPK1)
   04072 Phospholipase D signaling pathway
    109394900 (MAPK1)
   04071 Sphingolipid signaling pathway
    109394900 (MAPK1)
   04024 cAMP signaling pathway
    109394900 (MAPK1)
   04022 cGMP-PKG signaling pathway
    109394900 (MAPK1)
   04151 PI3K-Akt signaling pathway
    109394900 (MAPK1)
   04150 mTOR signaling pathway
    109394900 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109394900 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    109394900 (MAPK1)
   04210 Apoptosis
    109394900 (MAPK1)
   04218 Cellular senescence
    109394900 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109394900 (MAPK1)
   04520 Adherens junction
    109394900 (MAPK1)
   04540 Gap junction
    109394900 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    109394900 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109394900 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109394900 (MAPK1)
   04620 Toll-like receptor signaling pathway
    109394900 (MAPK1)
   04621 NOD-like receptor signaling pathway
    109394900 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    109394900 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    109394900 (MAPK1)
   04660 T cell receptor signaling pathway
    109394900 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    109394900 (MAPK1)
   04659 Th17 cell differentiation
    109394900 (MAPK1)
   04657 IL-17 signaling pathway
    109394900 (MAPK1)
   04662 B cell receptor signaling pathway
    109394900 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    109394900 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    109394900 (MAPK1)
   04062 Chemokine signaling pathway
    109394900 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109394900 (MAPK1)
   04929 GnRH secretion
    109394900 (MAPK1)
   04912 GnRH signaling pathway
    109394900 (MAPK1)
   04915 Estrogen signaling pathway
    109394900 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    109394900 (MAPK1)
   04917 Prolactin signaling pathway
    109394900 (MAPK1)
   04921 Oxytocin signaling pathway
    109394900 (MAPK1)
   04926 Relaxin signaling pathway
    109394900 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    109394900 (MAPK1)
   04919 Thyroid hormone signaling pathway
    109394900 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    109394900 (MAPK1)
   04916 Melanogenesis
    109394900 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109394900 (MAPK1)
   04270 Vascular smooth muscle contraction
    109394900 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109394900 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    109394900 (MAPK1)
   04725 Cholinergic synapse
    109394900 (MAPK1)
   04726 Serotonergic synapse
    109394900 (MAPK1)
   04720 Long-term potentiation
    109394900 (MAPK1)
   04730 Long-term depression
    109394900 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    109394900 (MAPK1)
   04722 Neurotrophin signaling pathway
    109394900 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    109394900 (MAPK1)
   04380 Osteoclast differentiation
    109394900 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109394900 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109394900 (MAPK1)
   05206 MicroRNAs in cancer
    109394900 (MAPK1)
   05205 Proteoglycans in cancer
    109394900 (MAPK1)
   05203 Viral carcinogenesis
    109394900 (MAPK1)
   05230 Central carbon metabolism in cancer
    109394900 (MAPK1)
   05231 Choline metabolism in cancer
    109394900 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109394900 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109394900 (MAPK1)
   05212 Pancreatic cancer
    109394900 (MAPK1)
   05225 Hepatocellular carcinoma
    109394900 (MAPK1)
   05226 Gastric cancer
    109394900 (MAPK1)
   05214 Glioma
    109394900 (MAPK1)
   05216 Thyroid cancer
    109394900 (MAPK1)
   05221 Acute myeloid leukemia
    109394900 (MAPK1)
   05220 Chronic myeloid leukemia
    109394900 (MAPK1)
   05218 Melanoma
    109394900 (MAPK1)
   05211 Renal cell carcinoma
    109394900 (MAPK1)
   05219 Bladder cancer
    109394900 (MAPK1)
   05215 Prostate cancer
    109394900 (MAPK1)
   05213 Endometrial cancer
    109394900 (MAPK1)
   05224 Breast cancer
    109394900 (MAPK1)
   05223 Non-small cell lung cancer
    109394900 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109394900 (MAPK1)
   05020 Prion disease
    109394900 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    109394900 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    109394900 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109394900 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109394900 (MAPK1)
   04934 Cushing syndrome
    109394900 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109394900 (MAPK1)
   05135 Yersinia infection
    109394900 (MAPK1)
   05133 Pertussis
    109394900 (MAPK1)
   05152 Tuberculosis
    109394900 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109394900 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    109394900 (MAPK1)
   05164 Influenza A
    109394900 (MAPK1)
   05161 Hepatitis B
    109394900 (MAPK1)
   05160 Hepatitis C
    109394900 (MAPK1)
   05163 Human cytomegalovirus infection
    109394900 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109394900 (MAPK1)
   05165 Human papillomavirus infection
    109394900 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109394900 (MAPK1)
   05140 Leishmaniasis
    109394900 (MAPK1)
   05142 Chagas disease
    109394900 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109394900 (MAPK1)
   01524 Platinum drug resistance
    109394900 (MAPK1)
   01522 Endocrine resistance
    109394900 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109394900 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109394900 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109394900 (MAPK1)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109394900 (MAPK1)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109394900 (MAPK1)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109394900 (MAPK1)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109394900 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like
Other DBs
NCBI-GeneID: 109394900
NCBI-ProteinID: XP_019520995
LinkDB
Position
Un
AA seq 359 aa
MAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEH
QTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHL
SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHT
GFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHIL
GILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKR
IEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgatgtg
gggccgcgctacaccaacctctcgtacatcggcgagggcgcttacggcatggtgtgctct
gcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgagcac
cagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacatgag
aacatcattggaattaatgatattattcgagcgccaaccatcgagcaaatgaaagatgta
tatatagtacaggacctcatggagacagatctctacaagctcttgaagacacaacacctc
agcaacgaccatatctgctattttctttaccagatactcagagggttaaagtatatccat
tcagctaacgtactgcaccgtgacctcaaaccttccaacctgctgctcaacaccacctgc
gatctcaagatctgcgattttggcttggcccgtgttgcagatccagaccatgatcacaca
gggttcctgacggagtatgtagccacacgttggtacagggctcctgaaattatgttgaat
tccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagagatg
ctctccaataggcccatcttccctgggaagcattatctcgaccaactgaaccacattctg
ggtattcttggatccccatcacaggaagacctgaattgcataatcaatttaaaagctaga
aactatttgctttctcttccacacaaaaataaggtgccatggaacaggctgttcccaaat
gctgactccaaagctctggatttactggacaaaatgttgaccttcaaccctcacaagagg
attgaagtagaacaggcactggcccacccatatctggagcagtattatgacccaagtgat
gagcccattgctgaagcaccattcaagtttgacatggaattggatgacttgcctaaggag
aagctcaaggaactcatttttgaagagactgctagattccagccaggatacagatcttaa

DBGET integrated database retrieval system