KEGG   Hipposideros armiger (great roundleaf bat): 109386114Help
Entry
109386114         CDS       T04661                                 

Gene name
KMT5A
Definition
(RefSeq) lysine methyltransferase 5A
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109386114 (KMT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hai03036]
    109386114 (KMT5A)
Enzymes [BR:hai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109386114 (KMT5A)
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109386114 (KMT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 109386114
NCBI-ProteinID: XP_019504571
LinkDB All DBs
Position
Un
AA seq 352 aa AA seqDB search
MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTNGENVFTGQSKIYTYMSP
NKCSGIRSPLQEENSVAHHEVKCQGKPLAGIYRKREEKRNTGNAIRSTMKSEELKIKDAR
RGPLAPFPNQKSEASEPPKTPTSSCDSPNAAVAKPALKKPAKGKQAPRKKAQGKTQQNRK
LTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGE
FVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHS
KCGNCQTKLHDIDGVPHLILIASRDIEAGEELLYDYGDRSRASIEAYPWLKH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctagaggcaggaagatgtccaagccccgcgcggtggaggcggcggcggcggcggcg
gcggtggcagcgacggccccgggcccggagatggtggagcggaggggcccggggaggccc
cgcaccaacggggagaacgtgtttaccgggcaatcaaagatctatacctacatgagcccg
aacaaatgctctggaatacgttccccccttcaggaagagaactcagttgcacatcacgaa
gtcaaatgccaggggaagccattagccggaatctacaggaaacgggaagagaaaagaaac
actgggaatgcaatacgaagcaccatgaagtccgaggaactgaagatcaaagacgccagg
agaggtcccctggcaccttttccaaaccaaaaatccgaagcctcagaacctccaaaaact
ccgacctcgtcttgtgattctcccaatgcagccgtcgccaagccagccctgaaaaagccc
gccaagggcaaacaggcccctcggaaaaaagctcaaggaaaaacgcaacagaatcgcaaa
ctcacagatttctaccctgtgaggaggagctccaggaagagcaaagctgagctgcagtct
gaagaaaggaaaagaatagacgaattgattgaaagtgggaaggaagaaggcatgaagatt
gacctcatcgatggcaaaggcaggggcgtgatcgccaccaagcagttctcccggggcgag
tttgtggtggaataccacggggacctcatcgagatcacggacgccaagaaacgggaggct
ctgtacgcacaagacccctccaccggctgctatatgtactattttcagtacctgagcaaa
acctactgcgtggatgcaacgagagagacaaatcgcctgggaagactcatcaatcacagt
aaatgtgggaactgccaaaccaaactgcacgacatcgacggcgtgcctcacctcatcctc
atcgcctcccgtgacatcgaggccggggaggagctcctgtatgactacggggaccgaagc
cgggcttccatcgaagcctacccctggctgaagcattaa

DBGET integrated database retrieval system