KEGG   Hipposideros armiger (great roundleaf bat): 109386578
Entry
109386578         CDS       T04661                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04020  Calcium signaling pathway
hai04062  Chemokine signaling pathway
hai04064  NF-kappa B signaling pathway
hai04066  HIF-1 signaling pathway
hai04070  Phosphatidylinositol signaling system
hai04071  Sphingolipid signaling pathway
hai04150  mTOR signaling pathway
hai04270  Vascular smooth muscle contraction
hai04310  Wnt signaling pathway
hai04370  VEGF signaling pathway
hai04510  Focal adhesion
hai04540  Gap junction
hai04650  Natural killer cell mediated cytotoxicity
hai04662  B cell receptor signaling pathway
hai04666  Fc gamma R-mediated phagocytosis
hai04670  Leukocyte transendothelial migration
hai04713  Circadian entrainment
hai04720  Long-term potentiation
hai04723  Retrograde endocannabinoid signaling
hai04724  Glutamatergic synapse
hai04725  Cholinergic synapse
hai04726  Serotonergic synapse
hai04727  GABAergic synapse
hai04728  Dopaminergic synapse
hai04730  Long-term depression
hai04750  Inflammatory mediator regulation of TRP channels
hai04911  Insulin secretion
hai04912  GnRH signaling pathway
hai04916  Melanogenesis
hai04918  Thyroid hormone synthesis
hai04919  Thyroid hormone signaling pathway
hai04921  Oxytocin signaling pathway
hai04925  Aldosterone synthesis and secretion
hai04928  Parathyroid hormone synthesis, secretion and action
hai04929  GnRH secretion
hai04931  Insulin resistance
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai04960  Aldosterone-regulated sodium reabsorption
hai04961  Endocrine and other factor-regulated calcium reabsorption
hai04970  Salivary secretion
hai04971  Gastric acid secretion
hai04972  Pancreatic secretion
hai04973  Carbohydrate digestion and absorption
hai05017  Spinocerebellar ataxia
hai05022  Pathways of neurodegeneration - multiple diseases
hai05031  Amphetamine addiction
hai05032  Morphine addiction
hai05140  Leishmaniasis
hai05143  African trypanosomiasis
hai05146  Amoebiasis
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05164  Influenza A
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05214  Glioma
hai05223  Non-small cell lung cancer
hai05225  Hepatocellular carcinoma
hai05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109386578 (PRKCB)
   04012 ErbB signaling pathway
    109386578 (PRKCB)
   04014 Ras signaling pathway
    109386578 (PRKCB)
   04015 Rap1 signaling pathway
    109386578 (PRKCB)
   04310 Wnt signaling pathway
    109386578 (PRKCB)
   04370 VEGF signaling pathway
    109386578 (PRKCB)
   04064 NF-kappa B signaling pathway
    109386578 (PRKCB)
   04066 HIF-1 signaling pathway
    109386578 (PRKCB)
   04020 Calcium signaling pathway
    109386578 (PRKCB)
   04070 Phosphatidylinositol signaling system
    109386578 (PRKCB)
   04071 Sphingolipid signaling pathway
    109386578 (PRKCB)
   04150 mTOR signaling pathway
    109386578 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109386578 (PRKCB)
   04540 Gap junction
    109386578 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109386578 (PRKCB)
   04662 B cell receptor signaling pathway
    109386578 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    109386578 (PRKCB)
   04670 Leukocyte transendothelial migration
    109386578 (PRKCB)
   04062 Chemokine signaling pathway
    109386578 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    109386578 (PRKCB)
   04929 GnRH secretion
    109386578 (PRKCB)
   04912 GnRH signaling pathway
    109386578 (PRKCB)
   04921 Oxytocin signaling pathway
    109386578 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    109386578 (PRKCB)
   04918 Thyroid hormone synthesis
    109386578 (PRKCB)
   04919 Thyroid hormone signaling pathway
    109386578 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    109386578 (PRKCB)
   04916 Melanogenesis
    109386578 (PRKCB)
   04925 Aldosterone synthesis and secretion
    109386578 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109386578 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    109386578 (PRKCB)
   04971 Gastric acid secretion
    109386578 (PRKCB)
   04972 Pancreatic secretion
    109386578 (PRKCB)
   04973 Carbohydrate digestion and absorption
    109386578 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109386578 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109386578 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    109386578 (PRKCB)
   04727 GABAergic synapse
    109386578 (PRKCB)
   04725 Cholinergic synapse
    109386578 (PRKCB)
   04728 Dopaminergic synapse
    109386578 (PRKCB)
   04726 Serotonergic synapse
    109386578 (PRKCB)
   04720 Long-term potentiation
    109386578 (PRKCB)
   04730 Long-term depression
    109386578 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    109386578 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109386578 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109386578 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109386578 (PRKCB)
   05206 MicroRNAs in cancer
    109386578 (PRKCB)
   05205 Proteoglycans in cancer
    109386578 (PRKCB)
   05231 Choline metabolism in cancer
    109386578 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109386578 (PRKCB)
   05214 Glioma
    109386578 (PRKCB)
   05223 Non-small cell lung cancer
    109386578 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    109386578 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    109386578 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    109386578 (PRKCB)
   05032 Morphine addiction
    109386578 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109386578 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109386578 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109386578 (PRKCB)
   05164 Influenza A
    109386578 (PRKCB)
   05161 Hepatitis B
    109386578 (PRKCB)
   05163 Human cytomegalovirus infection
    109386578 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109386578 (PRKCB)
   05140 Leishmaniasis
    109386578 (PRKCB)
   05143 African trypanosomiasis
    109386578 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109386578 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hai01001]
    109386578 (PRKCB)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     109386578 (PRKCB)
Protein kinases [BR:hai01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   109386578 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 109386578
NCBI-ProteinID: XP_019505444
LinkDB
Position
Un
AA seq 673 aa
MADPAAGPPPGEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFKFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGGEGSEE
LRQKFERAKIGQGTKAPEEKTTNTISKSDTNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIGDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDVKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPELKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgaccccgctgcggggccgccgccgggcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcaaggattccagtgccaagtctgctgttttgtcgtgcacaagcggtgccatgaa
tttgtcactttctcctgcccaggcgctgacaaggggccagcctctgatgacccccggagc
aaacacaagtttaagatccacacttactccagccccacgttttgtgaccactgcgggtcc
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcatgatgaacgtccac
aagcgctgcgtgatgaacgtccccagcctctgtggcacggaccacacggagcgccgcggc
cgcatctacatccaggcgcacatcgagagggaagttctcatcgttgtcgtaagagatgcc
aaaaaccttgtacccatggaccccaacggcttgtcagatccttacgtgaaactgaagctc
attcctgaccccaagagtgagagcaaacagaagaccaaaaccatcaagtgctccctcaac
ccggagtggaatgagaccttcaaattccagctgaaagaatcggacaaggatagaagactg
tctgtggagatttgggactgggacctgaccagccgcaacgacttcatggggtctttgtcg
tttgggatctctgagctgcagaaagctggcgtcgatggctggtttaagctgctgagccag
gaggagggcgagtacttcaacgtgccggtgccgccggagggaggtgagggcagtgaggag
ctacggcagaagtttgagcgggccaagatcggtcaggggaccaaggctccggaggagaag
acaactaacaccatatccaaatcggacaccaatgggaacagagaccggatgaagctgacg
gattttaacttcctcatggtgcttgggaaaggcagctttggcaaggtcatgctctcggag
cggaaaggcacagacgagctgtacgccgtgaagatcctcaagaaggacgtggtgatccaa
gatgacgacgtggagtgcacgatggtggagaagcgggtgctggccctgcccgggaagccg
ccgttcctgacgcagctgcactcctgcttccagaccatggaccgcctgtatttcgtgatg
gagtacgtgaatggcggggacctcatgtatcacatccaacaggtcggccgcttcaaggag
cctcacgctgtgttttacgctgcagaaattgccatcgggctgttcttcctgcaaagcaag
ggcatcatttaccgggacctaaaacttgacaacgtgatgctggattctgagggccacatc
aagatcgctgacttcggcatgtgtaaggaaaatattggggacggcgtcacgacgaagacc
ttctgcggcaccccagactacatcgccccagagataattgcttatcagccgtatggaaag
tcagtggattggtgggcgttcggggtcctgctctatgaaatgctggctgggcaggcgccc
tttgaaggggaggacgaggacgagctcttccagtctatcatggagcacaacgtggcttat
ccaaagtcgatgtccaaggaagccgtggccatctgcaaagggctgatgaccaaacacccc
ggcaagcgcctgggctgtggccccgagggcgaacgagacgtgaaggagcacgcgttcttc
cggtatatcgattgggagaaactcgagcgcaaagagattcagccgccatataagccaaaa
gcttgtggacgaaatgctgaaaacttcgaccggtttttcacccgccacccgcccgtccta
acccctcctgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaattcctaaaacctgaactcaagagctaa

DBGET integrated database retrieval system