KEGG   Hipposideros armiger (great roundleaf bat): 109387138
Entry
109387138         CDS       T04661                                 

Gene name
RB1
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01522  Endocrine resistance
hai04110  Cell cycle
hai04218  Cellular senescence
hai04934  Cushing syndrome
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05169  Epstein-Barr virus infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05212  Pancreatic cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05222  Small cell lung cancer
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109387138 (RB1)
   04218 Cellular senescence
    109387138 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109387138 (RB1)
   05203 Viral carcinogenesis
    109387138 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109387138 (RB1)
   05225 Hepatocellular carcinoma
    109387138 (RB1)
   05226 Gastric cancer
    109387138 (RB1)
   05214 Glioma
    109387138 (RB1)
   05220 Chronic myeloid leukemia
    109387138 (RB1)
   05218 Melanoma
    109387138 (RB1)
   05219 Bladder cancer
    109387138 (RB1)
   05215 Prostate cancer
    109387138 (RB1)
   05224 Breast cancer
    109387138 (RB1)
   05222 Small cell lung cancer
    109387138 (RB1)
   05223 Non-small cell lung cancer
    109387138 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109387138 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109387138 (RB1)
   05161 Hepatitis B
    109387138 (RB1)
   05160 Hepatitis C
    109387138 (RB1)
   05163 Human cytomegalovirus infection
    109387138 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109387138 (RB1)
   05169 Epstein-Barr virus infection
    109387138 (RB1)
   05165 Human papillomavirus infection
    109387138 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109387138 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hai01009]
    109387138 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hai03000]
    109387138 (RB1)
Protein phosphatases and associated proteins [BR:hai01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109387138 (RB1)
Transcription factors [BR:hai03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    109387138 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Other DBs
NCBI-GeneID: 109387138
NCBI-ProteinID: XP_019506400
LinkDB
Position
Un
AA seq 924 aa
MPPKTHRRAAAASAAAPPAPPPPPPEEDPDQDSGSEDLPLARLDFEEAEEPDFTALCQKL
KIPDHVRERAWLTWEKVSSVDGVLEDYIQKKKELWGICIFIAAVDLDEMPFTFTELQKNI
ETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYDVLCALYSKLERTCELIYLTQPSSLISTE
INSMLVLKVSWITFLLAKGEVLQVEDDLVISFQLMLCVLDYFIKLSPPALLKEPYKTAVI
PINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLG
IIASNGLPEVESLSKQYEEIYLKNKDLDARLFLDHDKTLQADSTDSFEMQRTPQKNNPDE
ELNVILQQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGY
IFKEKFAKAVGQGCIEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHM
SLLACALEVVMATYSRSTSQNLDTGTDLSFPWILNVLNLKAFDFYKVIESFIKAEANLTR
DMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGPTDHLEPACPISLPLQNNHTAAD
MYLSPVKSPKKKGSTPRVNSTANAEAQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNT
LCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKII
VTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPH
IPRSPYKFSSSPLRIPGGNIYISPLKNPYKISEGLPTPTKMTPRSRILVSIGESFGTSEK
FQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQKKLAEM
TSTRTRMQKQKMNDSMHLSNTEEN
NT seq 2775 nt   +upstreamnt  +downstreamnt
atgccacccaaaacccaccggagagcagccgccgcctccgctgccgcacccccggcgccg
ccgccgccccctcctgaggaggaccccgaccaggacagtggctccgaggacctgcctctg
gccaggcttgactttgaagaagctgaagaacctgattttaccgcattatgtcagaaatta
aagataccagatcatgtcagagaaagagcttggttaacttgggagaaagtttcatctgtg
gatggagtattggaagattatattcaaaagaaaaaggaactatggggcatctgtatcttt
attgcagcagttgacctagatgagatgccgttcacttttactgagctacagaaaaacata
gagaccagtgtctataaattctttgacttactaaaagaaattgataccagtaccaaagtt
gataatgctatgtcaagactattgaagaagtatgatgtattgtgtgcactttacagcaaa
ttagaaaggacatgtgaacttatatatttgacacaaccaagcagtttgatatctactgaa
ataaattctatgttggtactaaaagtttcttggatcacatttttactagctaaaggggaa
gtattacaagtggaagatgatctggtgatctcatttcaattaatgctctgtgtccttgac
tattttatcaaactttcacctccagcattgctcaaagaaccatataaaacagcggtaata
cctattaatggttcacctcggacaccaaggcgaggtcagaacaggagtgcacggatagca
aaacaactagaaaatgatacaagaattattgaagttctctgtaaagaacatgaatgtaat
atagatgaggtgaaaaatgtttatttcaaaaattttataccttttatgaattctcttgga
attatagcttctaatggacttccagaggtggaaagtctttctaaacaatatgaagaaatt
taccttaaaaacaaagatctagatgcaagattatttctggatcatgataaaactcttcag
gctgattctacagacagttttgaaatgcagagaacaccacaaaaaaataaccctgatgaa
gagctgaatgtgattcttcaacagactccagttaggactgttatgaatactatccaacaa
ttaatgatgatcttaaattcagcaagtgatcaaccatcagaaaatctgatttcctatttt
aataactgcacagtgaatccaaaggaaagtatcctgaagagagtgaaggatattggatat
atctttaaagagaaatttgctaaagctgtgggacagggatgtatagaaattgggtcacag
cgatacaaacttggagttcgactgtattaccgagtaatggaatccatgcttaaatcagaa
gaagaaagattatccattcaaaattttagcaaactcttgaatgacaacatctttcatatg
tctttgttggcatgcgctcttgaggttgtaatggctacatatagcagaagtacatctcag
aatcttgatactggaacagatttgtccttcccatggattctgaatgtacttaatttaaaa
gcctttgatttttacaaagtgattgaaagttttatcaaagcagaagccaacttgaccaga
gatatgataaaacatttagaacgatgtgaacatcgaatcatggaatcccttgcatggctc
tcagattcacctttatttgatcttattaaacaagcaaaggaccgagaaggaccaactgat
caccttgaacctgcttgtcctatcagccttcctctccagaataatcacactgcagcagac
atgtatctttctcctgtaaaatccccaaagaaaaaagggtcaactccacgtgtaaattct
actgcaaatgcagaggcacaagcaacctcagccttccagactcagaagccattgaaatct
acctccctttcgctcttttacaaaaaagtataccgattggcatatcttcgactaaatacc
ctgtgtgcacgccttctgtctgaccacccagaactagaacatatcatctggacccttttc
cagcacacactgcaaaatgagtatgaactcatgagagacaggcatttggaccagattatg
atgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaagttcaaaatcatt
gtaacagcttacaaagatcttcctcatgctgttcaggagacatttaaacgggttttgatc
agagaagaggagtatgattctattatagtattctataactcagtcttcatgcagagactg
aaaacaaatattttgcaatatgcttctaccaggccccctaccttgtcaccaatacctcac
attcctcgaagcccttacaagttttccagttcacctttacggattcctgggggaaacatc
tatatatcaccactgaagaatccatataaaatttcagaaggtctgccaacaccaacaaaa
atgactccaagatcaagaatcttagtatcaattggtgaatcatttgggacttctgagaag
ttccagaaaataaaccagatggtgtgtaacagcgaccgtgtgctcaaaagaagtgctgaa
ggaagcaaccctcctaaaccactgaaaaaactacgctttgatattgaaggatcagatgaa
gcagatggaagcaaacatcttccaggggagtccaagtttcaaaagaaactggcagaaatg
acatctacccgaacacgaatgcagaagcagaaaatgaatgacagcatgcatctctcaaac
acggaagaaaactga

DBGET integrated database retrieval system